KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_2088Help
Entry
BACAU_2088        CDS       T01692                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BACAU_2088 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BACAU_2088 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BACAU_2088 (trpB)
Enzymes [BR:baq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BACAU_2088 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2270575..2271777)
Genome map
AA seq 400 aa AA seqDB search
MYPYPNEIGRYGEFGGKFVPETLMRPLEEIETAFTELKNDPVFHAEYKKLLFDYSGRPTA
LTFADRVSEYLGGAKIYLKREDLNHTGSHKINNALGQILLAKKMGKTKIIAETGAGQHGV
AAATAAAKFGFKCTVFMGEEDVARQSLNVFRMKLLGAEVVPVTSGNGTLKDATNEAIRYW
VQHCEDHFYLIGSVVGPHPYPYIVREFQKIIGEEAKEQLRRVEGTLPDKVVACVGGGSNA
MGIFQAFLDEDIELIGAEAAGKGIDTPLHAATIAKGTLGVIHGSMTYLIQDEYGQIIEPY
SISAGLDYPGIGPEHAYLHKSGRVTYESVTDDEAIAALRLLSETEGILPAIESAHALAKA
FEMAKDMDKDKIILVSLSGRGDKDVHTLMNVLENGVETHV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtatccatatccaaatgaaatcggaagatacggcgaattcggcggcaaatttgtccct
gaaacattgatgcggccccttgaggaaatcgaaacggctttcacagaattaaaaaatgat
cctgtttttcatgccgaatataaaaaactattgtttgattactccggaagaccgactgca
ttaacgttcgcagacagggtgtcagagtatttgggaggggcgaaaatctatctgaaaaga
gaagatttaaaccataccggctctcataaaattaacaacgcgttaggccagattctgctt
gctaaaaagatgggcaaaacgaaaatcatcgccgaaaccggtgcgggacagcacggtgtg
gctgccgcgacagccgccgcaaaattcggttttaaatgtacggtttttatgggtgaagaa
gacgttgcgcgccagtcgctgaacgtattccggatgaaactgctcggcgcggaagtggtg
ccggtcacaagcggcaacggcacgctgaaagatgcgacgaatgaggcaatcaggtattgg
gtccagcattgtgaagatcatttctatcttatcggttctgtagtgggtccgcacccatat
ccgtatatcgttcgcgaatttcagaaaatcatcggcgaggaagcgaaagaacagctccgc
cgggttgaaggaacgctcccggacaaggttgttgcatgtgtcggcggcggaagcaatgcg
atgggcatatttcaggcctttttagacgaagacattgagctgatcggcgccgaggcggcc
ggaaaagggattgatacgccgctgcatgcggcaacgatcgcaaaagggacgctcggggtg
attcacggatcaatgacctatttaatacaagatgaatacgggcagattatcgaaccgtat
tccatttcagcaggccttgattacccggggatcggccctgagcacgcctatctgcacaaa
agcggccgtgtaacgtacgaaagcgtgacagacgatgaagcgattgccgcgttacgtctg
ctttctgaaacagaaggtattcttccggctattgaatctgcccacgccctggcaaaagcg
ttcgaaatggcaaaggacatggataaagacaaaatcattctcgtcagtttgtcgggaaga
ggagataaagatgttcatacgctgatgaatgttttggaaaacggggtggagacacatgtt
taa

DBGET integrated database retrieval system