KEGG   Bacillus velezensis CAU B946: BACAU_2330Help
Entry
BACAU_2330        CDS       T01692                                 

Gene name
glcK
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
baq  Bacillus velezensis CAU B946
Pathway
baq00010  Glycolysis / Gluconeogenesis
baq00052  Galactose metabolism
baq00500  Starch and sucrose metabolism
baq00520  Amino sugar and nucleotide sugar metabolism
baq00521  Streptomycin biosynthesis
baq01100  Metabolic pathways
baq01110  Biosynthesis of secondary metabolites
baq01120  Microbial metabolism in diverse environments
baq01130  Biosynthesis of antibiotics
baq01200  Carbon metabolism
Module
baq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
baq_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BACAU_2330 (glcK)
   00052 Galactose metabolism
    BACAU_2330 (glcK)
   00500 Starch and sucrose metabolism
    BACAU_2330 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    BACAU_2330 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BACAU_2330 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BACAU_2330 (glcK)
Enzymes [BR:baq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BACAU_2330 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FtsA
Motif
Other DBs
NCBI-ProteinID: CCF05864
Position
complement(2533176..2534138)
Genome map
AA seq 320 aa AA seqDB search
MEDTWFAGIDLGGTTIKLAFINMYGEIQHKWEVPTDKSGNTITVTIAKALDQKLEELNKP
KRIVKWIGMGAPGPVEMTTGMVYETTNMGWKNYPLKDHLEAETGIPAVIENDANIAALGE
MWKGAGDGAKDVILVTLGTGVGGGIIVNGEIVHGKNGAGGEIGHICSIPEGGAPCNCGKS
GCIETIASATGIVRIAKEKLAAVSDSSLLQVRDLTARDVFEAAKQQDKTALEVVDYVAKH
LGLVLGNLASAMNPTKIVLGGGVSKAGEILRSKVEETFKITAFPRSAEAADISIAALGND
AGVIGGAWIAKNEWLKHQNC
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggaagatacatggtttgcggggattgatctgggcggaacaaccatcaagctggccttt
atcaacatgtacggtgaaattcagcataaatgggaagttccgaccgataaatccggaaac
acaattacggtcacgatcgccaaagcgcttgatcagaagctggaagaactgaacaagccg
aaacggattgtaaaatggatcggaatgggagcgcccggacctgtggaaatgacgacggga
atggtctatgagacgacaaatatggggtggaaaaactatccgctgaaagaccatctcgag
gcggaaacgggtattccggccgtcattgaaaacgatgccaatatcgcggcgctcggagaa
atgtggaagggtgcaggtgatggggccaaagatgtcattttagtgacgctcggaaccgga
gtcggcggaggcatcatcgtcaacggagaaatcgttcacggtaaaaacggggccggcgga
gaaatcggtcatatttgcagtattccggaaggaggagctccgtgcaattgcggaaaatcc
ggctgcatcgaaacgattgcgtccgcaaccggcatcgtccgcatcgcgaaagaaaagctt
gcggcggtttccgactcttcgctcttacaagtgcgcgatctgacggcacgtgacgtgttc
gaagcggctaaacagcaggataagaccgcgcttgaagtcgtcgattatgtcgcaaaacat
ttaggcctcgtgctcggaaatctggcaagcgccatgaatccgacaaaaatcgtgctcggc
ggaggcgtgtctaaagcgggggaaatcctgcggtcaaaagtggaagagaccttcaaaatc
accgcgttcccgcgttctgcggaagcggccgatatttcgattgcggcacttggaaatgac
gccggagtcatcggcggggcgtggattgccaaaaatgaatggctcaaacatcaaaactgc
tga

DBGET integrated database retrieval system