KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_2330Help
Entry
BACAU_2330        CDS       T01692                                 

Gene name
glcK
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BACAU_2330 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BACAU_2330 (glcK)
   00052 Galactose metabolism
    BACAU_2330 (glcK)
   00500 Starch and sucrose metabolism
    BACAU_2330 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    BACAU_2330 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BACAU_2330 (glcK)
   00524 Butirosin and neomycin biosynthesis
    BACAU_2330 (glcK)
Enzymes [BR:baq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BACAU_2330 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2533176..2534138)
Genome map
AA seq 320 aa AA seqDB search
MEDTWFAGIDLGGTTIKLAFINMYGEIQHKWEVPTDKSGNTITVTIAKALDQKLEELNKP
KRIVKWIGMGAPGPVEMTTGMVYETTNMGWKNYPLKDHLEAETGIPAVIENDANIAALGE
MWKGAGDGAKDVILVTLGTGVGGGIIVNGEIVHGKNGAGGEIGHICSIPEGGAPCNCGKS
GCIETIASATGIVRIAKEKLAAVSDSSLLQVRDLTARDVFEAAKQQDKTALEVVDYVAKH
LGLVLGNLASAMNPTKIVLGGGVSKAGEILRSKVEETFKITAFPRSAEAADISIAALGND
AGVIGGAWIAKNEWLKHQNC
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggaagatacatggtttgcggggattgatctgggcggaacaaccatcaagctggccttt
atcaacatgtacggtgaaattcagcataaatgggaagttccgaccgataaatccggaaac
acaattacggtcacgatcgccaaagcgcttgatcagaagctggaagaactgaacaagccg
aaacggattgtaaaatggatcggaatgggagcgcccggacctgtggaaatgacgacggga
atggtctatgagacgacaaatatggggtggaaaaactatccgctgaaagaccatctcgag
gcggaaacgggtattccggccgtcattgaaaacgatgccaatatcgcggcgctcggagaa
atgtggaagggtgcaggtgatggggccaaagatgtcattttagtgacgctcggaaccgga
gtcggcggaggcatcatcgtcaacggagaaatcgttcacggtaaaaacggggccggcgga
gaaatcggtcatatttgcagtattccggaaggaggagctccgtgcaattgcggaaaatcc
ggctgcatcgaaacgattgcgtccgcaaccggcatcgtccgcatcgcgaaagaaaagctt
gcggcggtttccgactcttcgctcttacaagtgcgcgatctgacggcacgtgacgtgttc
gaagcggctaaacagcaggataagaccgcgcttgaagtcgtcgattatgtcgcaaaacat
ttaggcctcgtgctcggaaatctggcaagcgccatgaatccgacaaaaatcgtgctcggc
ggaggcgtgtctaaagcgggggaaatcctgcggtcaaaagtggaagagaccttcaaaatc
accgcgttcccgcgttctgcggaagcggccgatatttcgattgcggcacttggaaatgac
gccggagtcatcggcggggcgtggattgccaaaaatgaatggctcaaacatcaaaactgc
tga

DBGET integrated database retrieval system