KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_2537Help
Entry
BACAU_2537        CDS       T01692                                 

Gene name
hemD3
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:baq00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2728321..2729103)
Genome map
AA seq 260 aa AA seqDB search
MANDLPLQGKTVLVTRNKRQAAPFRKKVEALGGTAVSASLIAFQEALPDECADSLREDLS
EPGWLVFTSVNGVRFFFSYLDQHGLALPERKKIAAVGEKTARALKERGARTDAMPDEYVA
ECLADTLKRHASAAEPVSLIKGNLSRDVIKAELEPLGYQIREWVLYNTIQDEKGMDELRR
AASRSHFDFITFTSSSAVHTFMHAVGDGEKAWENSGASYISIGPLTEKALLEYGISSHVP
DTYTIEGMLDVMCSMSGKDR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgaccttcctttacaaggaaagaccgtgctcgtcacccggaacaaaagacag
gcagcaccgtttcgaaaaaaagtggaggcgctcggcggaacggctgtttccgcctctctg
atcgcttttcaggaagcgctcccggatgaatgtgcggacagtctgcgggaagacctttct
gaaccgggctggcttgtgtttacaagcgtaaacggtgtccggttctttttttcctacctt
gatcagcatggccttgcgcttccggaacggaaaaaaatcgcagccgtcggtgaaaagaca
gcgcgcgccctgaaagagcggggagcccggacggatgcgatgcctgacgagtatgtggcg
gaatgtctggctgatactttaaaacggcacgcatcagctgccgaacccgtttcattgata
aagggcaatttatcacgcgatgtcataaaagcggagcttgagccgcttggctatcaaata
agggaatgggtgttatacaataccattcaggatgaaaaaggcatggacgagctgagacgg
gctgcatcccgctctcattttgattttattacgtttaccagttcatcggcggtgcatacg
tttatgcacgcggtcggagacggagaaaaagcgtgggaaaacagcggtgcgagctatatc
agcatcggccctttgacagagaaagcgctcttggaatacgggatctcatcccatgtgcct
gacacctatacgattgaaggcatgctggacgtcatgtgcagcatgtcgggaaaggataga
taa

DBGET integrated database retrieval system