KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_2576Help
Entry
BACAU_2576        CDS       T01692                                 

Gene name
ysiB
Definition
enoyl-CoA hydratase
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BACAU_2576 (ysiB)
  Lipid metabolism
   00071 Fatty acid degradation
    BACAU_2576 (ysiB)
Enzymes [BR:baq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BACAU_2576 (ysiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2768990..2769769)
Genome map
AA seq 259 aa AA seqDB search
MNSLSMAVEQSVAVITINHQPANALSGAVLDELSGLFDRCETDDSVRSIIIRGEGKFFSA
GADIKEFTSLENLEQSSAMADKGQQLMERIEGFPKPVIAAIHGAALGGGLELAMACHIRI
ATLDAKLGLPELNLGIIPGFAGTQRLPRYVGTAKALEMIGTSEPVTGEEALSLGLVTIGA
EHEEELLQKAKTLAGKFAEKSPQSMASLLELLYSNKVYSYDGGLKLEAKRFGEAFASDDA
KEGIQAFLEKRKPQFGGRR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcctttcgatggcggtagaacaatctgttgcggtgatcaccattaatcatcag
ccggccaacgcgctgtccggcgcggttttagatgagttgtccggtctgttcgaccgctgt
gaaacagatgacagtgtcagaagcatcatcattcgcggagaggggaaatttttctcggcg
ggcgctgatataaaggaatttacgtcgcttgaaaatcttgagcaatcttctgccatggca
gataaaggccagcagctgatggaaagaattgaagggtttccgaagcccgttatcgcggcg
attcacggcgctgcgctcggcggcggccttgagcttgccatggcctgccatatcagaatc
gctacattagatgcaaagctcggcctgcccgagctgaatctcggcattattccgggcttt
gccgggacgcagcggcttccccggtacgtcggtacggcgaaagcgcttgaaatgatcggc
acttcagaacctgtaaccggagaagaagcgctcagcctcggtcttgtcacgataggcgcc
gaacatgaagaagagctgctgcaaaaagcgaaaacgctcgcgggcaagtttgcggaaaaa
agcccgcagtcgatggcttctctgcttgagctcctttattcaaacaaggtctattcttat
gacggcggcttaaagcttgaagcaaagcgctttggggaagcatttgcatcagatgacgca
aaagaaggcattcaggcatttctcgaaaaaagaaagcctcaattcggtgggcgaagataa

DBGET integrated database retrieval system