KEGG   Bacillus velezensis CAU B946: BACAU_2641Help
Entry
BACAU_2641        CDS       T01692                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
baq  Bacillus velezensis CAU B946
Pathway
baq00010  Glycolysis / Gluconeogenesis
baq00030  Pentose phosphate pathway
baq00051  Fructose and mannose metabolism
baq00052  Galactose metabolism
baq00680  Methane metabolism
baq01100  Metabolic pathways
baq01110  Biosynthesis of secondary metabolites
baq01120  Microbial metabolism in diverse environments
baq01130  Biosynthesis of antibiotics
baq01200  Carbon metabolism
baq01230  Biosynthesis of amino acids
baq03018  RNA degradation
Module
baq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
baq_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BACAU_2641 (pfkA)
   00030 Pentose phosphate pathway
    BACAU_2641 (pfkA)
   00051 Fructose and mannose metabolism
    BACAU_2641 (pfkA)
   00052 Galactose metabolism
    BACAU_2641 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BACAU_2641 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BACAU_2641 (pfkA)
Enzymes [BR:baq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BACAU_2641 (pfkA)
Protein phosphatases and associated proteins [BR:baq01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BACAU_2641 (pfkA)
Messenger RNA biogenesis [BR:baq03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BACAU_2641 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: CCF06175
Position
complement(2839087..2840046)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYSGLISGKIEKLELGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMEEIIGRLKRGHDRGKKHSIIIVAEGVGSGVEFGKRIEEETNL
ETRVSVLGHIQRGGSPSASDRVLASRLGAYAVELLLKGKGGRCVGIQNNKLVDHDIIEIL
ESKHTVEPNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtataggagttttaacgagcggcggggattccccgggtatgaacgctgcggtg
cgcgcggttgtgcggaaagctatctaccacgacgtcgaagtgtacggaatttataacggt
tattcaggattaatcagcggaaaaatagaaaaactggagctgggttcggtcggtgacatc
atccaccgcggcggaacaaagctgtatacggccagatgtcctgaattcaaaacagttgaa
ggccgtgaaaaaggaatcgaaaatttaaagaaactcggcattgaaggtcttgtcgtcatc
ggcggagacggttcatacatgggtgcgaaaaaattaacggaacacgggtttccgtgtgta
ggtgtaccgggtacgatagataatgacatcccgggaactgattttacgatcggatttgat
acggcgttaaacaccgtaattgatgcgattgataaaatccgtgacaccgctacgtctcat
gagcgtacatacgttattgaagtgatggggcgccatgcgggcgacattgctttatgggca
ggtcttgcaggcggagcggaatcaatcttaattcctgaagcggactacgatatggaggaa
attatcggccgtttgaagagagggcacgaccgcggcaaaaaacacagtatcatcatcgtt
gcagaaggggtaggcagcggggttgaattcggaaaacgcatcgaagaagaaacgaacctt
gaaacacgggtatccgttttagggcacatccagcgcggcggatctccaagcgcttctgac
cgggttcttgcaagccgcctcggcgcttacgcggttgagcttctgcttaaaggaaaaggc
ggacgctgcgtaggtatacaaaacaacaagcttgtagaccatgatattatagaaatttta
gaatcaaaacatactgttgaaccaaacatgtatcagctttcaaaagaactgtctatttaa

DBGET integrated database retrieval system