KEGG   Bacillus velezensis CAU B946: BACAU_2667Help
Entry
BACAU_2667        CDS       T01692                                 

Gene name
acsA1
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
baq  Bacillus velezensis CAU B946
Pathway
baq00010  Glycolysis / Gluconeogenesis
baq00620  Pyruvate metabolism
baq00640  Propanoate metabolism
baq00680  Methane metabolism
baq01100  Metabolic pathways
baq01110  Biosynthesis of secondary metabolites
baq01120  Microbial metabolism in diverse environments
baq01130  Biosynthesis of antibiotics
baq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BACAU_2667 (acsA1)
   00620 Pyruvate metabolism
    BACAU_2667 (acsA1)
   00640 Propanoate metabolism
    BACAU_2667 (acsA1)
  Energy metabolism
   00680 Methane metabolism
    BACAU_2667 (acsA1)
Enzymes [BR:baq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BACAU_2667 (acsA1)
Lipid biosynthesis proteins [BR:baq01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BACAU_2667 (acsA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Ribosomal_L6e_N
Motif
Other DBs
NCBI-ProteinID: CCF06201
Position
complement(2864977..2866563)
Genome map
AA seq 528 aa AA seqDB search
MLKREDLIAPKNYNLVNEIEKFSRSKEKNALIWEDQTGGKKVWTYEKLMEETNKIGARLK
GLGFEKGDKLIVMVPRVLEAYAVYLAILKAGMVVIPCSEMLRAKDLEYRIKHAEVKGAIV
YPSFINAFDEVNTEQLVTLSIGENDAGWKNLLTIEADGNSFQTADTTREDMAFLSYTSGT
TGQPKGVVHTHGWAFAHLKTSAGAWLDISEDDTVWATAAPGWQKWVWSPLLAVLGSGATG
FIYHGRFNAKTYLELLERHQVNVFCCTPTEYRLMAKVEELDKYDLSALHSAVSAGEPLNR
EVIDVFRKHFGIKVRDGYGQTESTLLVGVLKDMDIKPGSMGKPTPGNQVEIINDKGEICE
TGETGDIAVHLSTPALFKEYYKDPERTKKQIRGDYFLTGDRAKKDEDGYFWFESRNDDII
VSSGYTIGPFEVEDALVKHPEVKECAVVASPDEIRGSIVKAYVVLQDDEKRSGELVKELQ
NHVKTITAPYKYPREIEFVESLPKTASAKIRRVELRQREERLKADKKA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaaacgagaagatttaatcgccccaaagaactataaccttgtaaatgaaatcgaa
aagttcagccgttccaaagagaagaacgcgcttatttgggaagatcaaacaggcggcaag
aaagtctggacgtatgaaaaattgatggaagaaacgaataaaatcggagcccgcctgaaa
ggtctcggatttgaaaaaggcgataagctgattgtcatggttccgagagtgcttgaagcg
tatgccgtttatttagcgatcttaaaagcggggatggtcgtcattccttgctcggaaatg
ctgcgcgccaaagaccttgaataccggatcaaacacgccgaagtgaaaggcgctatcgtt
tatccttcatttataaacgcatttgacgaggtgaataccgagcagctggtgacattgtca
atcggtgaaaatgatgcaggctggaaaaacctcttaacgattgaagcggacggaaacagt
tttcaaacagctgatacaacaagagaggacatggcgtttttgtcctatacttcaggcacg
accggccagcctaaaggcgttgtacatacacacggctgggcctttgcccatttaaaaact
tcagccggtgcatggctggatatttccgaagacgatacagtgtgggccaccgcggcgccc
ggctggcagaaatgggtgtggagcccgctgctcgccgttctgggaagcggcgcgacagga
ttcatttatcacggcagattcaacgccaagacgtatttagagctgctggagcgccatcaa
gtaaatgtcttctgctgtaccccgacggaataccgcctgatggcaaaagtggaggagttg
gacaaatatgatctttctgcccttcacagcgcagtttctgcgggtgagccattaaaccgg
gaagtcattgacgtattccggaagcatttcggtattaaagtgagagacggatacggccaa
acggagagcaccctgttagtcggcgtcctgaaggatatggatattaagccgggaagcatg
ggcaaaccgacccccggaaatcaagtagagattataaacgataagggcgaaatatgcgaa
acaggcgaaacgggcgatatcgccgtgcatttgagcacaccggccttattcaaggaatat
tataaagatcccgaaagaacgaaaaagcagattcgcggagattactttcttacaggagac
cgcgcgaaaaaagacgaggacggctacttttggtttgagagccgcaatgatgacattatc
gtcagctccggatatacaatcgggccttttgaagtagaggacgcgctcgtgaagcatccg
gaagtgaaagaatgtgcagtcgtggcaagcccggatgaaatcagaggttcaatcgtaaaa
gcttatgtcgttttacaagacgatgaaaagcgcagtggcgaacttgtcaaagaactgcaa
aaccacgtaaaaacgattacggcgccttacaaatatccgagagaaattgaatttgtcgaa
agcctgccgaaaacggcgtccgcaaaaatcagacgtgtggaactgagacagcgtgaagaa
cggctgaaggctgataaaaaagcataa

DBGET integrated database retrieval system