KEGG   Bacillus velezensis CAU B946: BACAU_2696Help
Entry
BACAU_2696        CDS       T01692                                 

Gene name
acsA3
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
baq  Bacillus velezensis CAU B946
Pathway
baq00010  Glycolysis / Gluconeogenesis
baq00620  Pyruvate metabolism
baq00640  Propanoate metabolism
baq00680  Methane metabolism
baq01100  Metabolic pathways
baq01110  Biosynthesis of secondary metabolites
baq01120  Microbial metabolism in diverse environments
baq01130  Biosynthesis of antibiotics
baq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BACAU_2696 (acsA3)
   00620 Pyruvate metabolism
    BACAU_2696 (acsA3)
   00640 Propanoate metabolism
    BACAU_2696 (acsA3)
  Energy metabolism
   00680 Methane metabolism
    BACAU_2696 (acsA3)
Enzymes [BR:baq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BACAU_2696 (acsA3)
Lipid biosynthesis proteins [BR:baq01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BACAU_2696 (acsA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CCF06230
Position
complement(2893322..2895040)
Genome map
AA seq 572 aa AA seqDB search
MNLKALPAEKGNYHLRNYEETYRSFDWKEVEAEFSWHQTGKLNAAYEAIDRHAESFRKNK
VALYYKDANRNEKYTFKEMMEESNRAGNVLRRYGNVEKGDRVFIFMPRSPELYFIMLGAI
KIGAIAGPLFEAFMEGAVKDRLLNSQAKVVVTIPELAERIPADSLPDLEHIFIVGGSKEA
GDKIIHYDKAAEGESTRLDIEWMDRRDGYLLHYTSGSTGTPKGVLHVHEAMIQQYQTGKW
VLDLKEDDIYWCTADPGWVTGTVYGIFAPWLNGAANVIVGGRFSPENWYGTIEKLGVSVW
YSAPTAFRMLMGAGDEMASKFDLTSLRHVLSVGEPLNPEVIKWGHKVFGKRIHDTWWMTE
TGGQLICNYPCMEIKPGSMGKPIPGVEAAIVDNQGNELPPYRMGNLAIKKGWPSMMDSIW
NNKEKYDSYFMPGGWYVSGDSAYMDEDGYFWFQGRVDDVIMTSGERVGPFEVESKLVEHP
AIAEAGVIGKPDPVRGEIIKAFIALREGHEPSDQLKEDIRLFVKQGLAAHAAPREIEFKD
KLPKTRSGKIMRRVLKAWELNLPAGDLSTMED
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgaaagcgttgccggcggaaaaggggaattatcatctgcgaaattatgaggaa
acgtaccgcagcttcgattggaaagaggtcgaagcggagttttcctggcatcagacgggg
aagctgaatgcggcgtacgaagcaattgaccgtcatgccgaatcatttcgaaaaaacaaa
gtagcgctgtattacaaggacgcaaatcggaatgaaaaatacacatttaaagaaatgatg
gaggaatcgaaccgggcgggaaatgtactgagacggtatggaaacgtggaaaaaggggac
cgcgtttttattttcatgccgcgttcgccggagctttactttatcatgctcggcgcaatt
aaaatcggtgcgatcgccggccctttatttgaagcgtttatggaaggcgccgtcaaagac
cgcctgttgaacagccaggcaaaggttgtcgtgacgatacctgaactggccgaacggatt
ccggcggacagcctgcccgacctcgagcatattttcattgtcggaggcagcaaagaagcg
ggagataaaatcattcattatgataaagcggctgagggagaaagcacgagacttgatatt
gaatggatggacagaagagacggctacctgcttcactacacatcaggatctaccggaacg
cccaaaggtgtgctccacgttcatgaagccatgattcagcaataccagaccggcaagtgg
gtgcttgatcttaaagaagacgatatttattggtgcactgcggaccccggctgggtgacc
gggacggtgtacgggatatttgcgccgtggctgaacggagcggcgaatgtgatcgtcggc
ggcagattcagtccggaaaactggtacggcacgattgagaagcttggtgtcagcgtctgg
tacagcgctccgacggctttcagaatgcttatgggcgccggagatgaaatggcatccaaa
tttgaccttacttcacttcgtcacgtcctgagtgtcggagaacctttgaaccccgaggtc
atcaagtggggacataaagtattcggcaagcgcatccacgacacgtggtggatgacagaa
acgggcggacagctcatctgcaattatccttgcatggagatcaagccgggctcaatgggg
aaaccgattccgggagtggaagcggcgatcgttgacaatcagggaaatgagcttccgccg
taccgaatgggaaatctcgccattaaaaagggctggccgtcgatgatggattccatttgg
aacaacaaagagaaatatgattcttattttatgccgggcggctggtatgtttccggagat
tctgcttatatggatgaagacggttatttttggttccaaggcagagtcgatgatgtcatc
atgacatccggcgagcgcgtcggcccgtttgaagtcgaaagcaaacttgttgaacatccg
gcgattgccgaagccggcgtcatcggaaagccggaccctgtccggggagaaattattaaa
gcgtttatcgcgctcagagaagggcatgagccatccgatcagctgaaggaggacattcgc
ctctttgtaaaacaggggcttgccgcgcatgccgcaccgcgggaaattgaattcaaagat
aaacttccgaaaacacggagcggaaaaatcatgagacgtgtgctgaaggcatgggagctg
aacctgccggcaggcgacctgtcaacaatggaagattaa

DBGET integrated database retrieval system