KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_2724Help
Entry
BACAU_2724        CDS       T01692                                 

Gene name
ytjP
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BACAU_2724 (ytjP)
  Amino acid metabolism
   00300 Lysine biosynthesis
    BACAU_2724 (ytjP)
Enzymes [BR:baq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BACAU_2724 (ytjP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2920393..2921784)
Genome map
AA seq 463 aa AA seqDB search
MNWEVEVIRNKEDLIRDTQKFLQINSVMDESTAGPGRPFGEGVNASLASLLEFGKKEGFT
VKNLDGYAGHIEWGTGDEIVGVLCHVDVVPPGDGWTSDPFSADIRDGRIYARGAIDDKGP
TMAAFYALKIVKDMQLPLSKRVRIIIGTDEESDWRCVDHYFKHEKMPDIGFAPDADFPII
NAEKGIIDASLRIVKNASDKDAKNVLLSFRSGLRLNMVPDAAEAVIEGNGIDAVHAYFSK
WLEQSKTQGEAVSENGKLTLRVYGKSCHAMEPDNGINAGLKLAECLNGTELDGAGKHFVK
TVSDYFLNDTRGKKLKIDCRDDISGELTLNVGTFTYRKGEDGELGINIRYPVTSDSKVIR
DAFTSAEEFRLEEFKDSKPHHVSADHPLVKTLQKVYEGQTGKKADLISIGGGTYARSLSA
GVAFGPLFPGRPDSAHQKDEYIEIDDLLRSTALYAEAIYELAK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggaagttgaagtcatcagaaacaaagaagatctgatccgtgacacgcagaag
tttttgcagatcaacagcgtaatggacgaatcaacagccggtcccggccggccgtttgga
gaaggcgtcaatgccagcctggcgtcactgctggaattcggtaaaaaagaaggcttcacc
gtaaagaatcttgacggctatgcgggccatattgaatggggaacgggtgacgaaatcgtc
ggtgttttgtgccacgtcgatgtcgttccgcccggagacggctggacgagcgatccgttt
tcagccgatatcagggacggccggatatatgccagaggcgccattgatgataaagggccg
acaatggcggcgttttatgcgctgaaaatcgtcaaagacatgcagcttcctttatccaaa
cgcgtgagaatcatcatcggtacggatgaagaaagtgattggagatgcgtggatcactac
ttcaaacacgaaaaaatgcctgacatcggctttgctcctgacgcagattttccgatcatt
aacgcggaaaaaggaattatagatgcgtcactgcgcattgtaaaaaacgcttctgacaaa
gacgcaaaaaacgtgcttctgtcattccgttcaggactgcgcttgaacatggtgccggat
gcggctgaagcggttattgaagggaacggtattgatgccgtgcacgcatatttcagcaaa
tggcttgagcagtcaaaaacacaaggtgaagcagtttcggaaaatggaaaactgacgctt
cgggtatacgggaaatcatgccacgcgatggaaccggataatggtatcaatgccggctta
aagcttgctgaatgccttaacggaacagagctggatggagccggaaagcactttgtcaaa
accgtcagtgactattttttaaatgatacacgaggcaaaaagctgaaaattgattgcagg
gatgacatcagcggagagcttacattgaatgtcggcacctttacatacagaaagggtgag
gatggagaactcggcatcaacatccgttatcccgtcacttcagacagcaaagtcatccgt
gatgcttttacgtctgctgaagaattccggcttgaagaatttaaagacagcaaaccgcac
cacgtttctgccgatcatccgctagtaaagacgcttcaaaaggtttacgaaggacagacg
ggaaagaaagcggatctgatttcaatcggcggaggaacgtatgcgagatccctttcggcg
ggcgtcgcgttcggtccgctgttccccggccggcctgacagcgcgcatcaaaaggatgag
tacattgaaatcgatgaccttctcaggtcaacggctttatatgccgaagccatttatgaa
cttgccaagtga

DBGET integrated database retrieval system