KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_2738Help
Entry
BACAU_2738        CDS       T01692                                 

Gene name
melA
Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:baq00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:baq00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:baq00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2935821..2937119
Genome map
AA seq 432 aa AA seqDB search
MKKITFIGAGSTIFAKNVLGDCLLTEALNGFEFALYDIDAVRLKESQLMLENMRDRYNPS
ISIISYDDRKQALTHAGYVINAIQVGGYKPATVIDFDIPKRYGLRQTIADTVGIGGIFRS
LRTIPVLFDIAKDMEEVCPDAWLLNYTNPMASLTGAMLRHTNVKTVGLCHSVQVCTKDLF
DSLGMDHEGTEERIAGINHMAWLLEIKKDGIDLYPEIKRRAREKQKTKHKDMVRFELMDK
FGCYVTESSEHNAEYHPYFIKSRYPELIDELQIPLDEYPRRCAEQIKNWETMRDGIINNQ
NLTHERSKEYGSRIIEAMETGRPFTFGGNVLNTGLIPNLPAKAVVEVPCAAVKNQIMPCY
SGELPEQLAALNRTNINTQLLTIEAAVTLKKEAVYQAAMLDPHTSAELSMNDIISLCDDL
FEAHKDRLPAYH
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaattacgtttatcggagcggggagcacgattttcgcaaaaaatgtattgggg
gactgtttactgactgaagcattaaacggatttgaattcgcgctttatgatattgacgct
gtacggctgaaagaatctcagctcatgctggaaaacatgagagaccgctacaatccgagt
atatccatcatctcctacgatgaccgaaaacaggcgcttacacacgccggctatgtgata
aacgccattcaggtcggaggctataaacccgcgacggtcattgactttgacatcccgaag
cggtacggtctccgccagacgattgccgataccgtcggaataggcggcattttccgttcc
ctccgcaccatccccgttttatttgacattgcaaaagacatggaagaggtctgcccggat
gcgtggctgttaaactatacaaatccgatggcctctctgaccggagcgatgctcagacat
acaaatgtcaaaacggtcggcctgtgccacagcgtccaggtctgtaccaaagatctgttc
gactcactcggcatggatcacgaaggtacggaagaacgcattgccggcatcaaccatatg
gcttggcttttggagattaaaaaagacggaattgatttatatccggaaattaaaagacgg
gcacgcgaaaaacaaaagacgaaacataaggacatggtgcggtttgagctgatggataaa
ttcggctgctacgtgacggaatcatctgagcataatgccgaatatcacccgtattttata
aaaagccggtatccggagctgatagatgaactccaaattccgcttgatgaatatccgagg
agatgcgcggaacaaatcaaaaactgggaaacgatgagagacgggatcatcaacaaccaa
aacctgacgcatgaacgctcgaaagaatacggttcgagaattatagaagcgatggagacg
ggccgtccgttcacattcggcggcaatgtgctgaataccgggctgataccgaatctgccg
gcgaaagcggtcgttgaagtgccgtgcgccgccgttaaaaaccaaattatgccgtgctat
tccggcgaacttccggagcagctcgcggcgctcaacagaacaaacatcaacacacagctt
ttaaccatcgaagcggccgttacattaaaaaaggaagccgtatatcaagcggccatgctt
gatccgcatacgagcgccgagctttccatgaatgacatcatctctttgtgcgatgactta
tttgaagcgcacaaagaccggcttccggcttatcactga

DBGET integrated database retrieval system