KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_2965Help
Entry
BACAU_2965        CDS       T01692                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BACAU_2965 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BACAU_2965 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BACAU_2965 (thrC)
Enzymes [BR:baq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BACAU_2965 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3174177..3175244)
Genome map
AA seq 355 aa AA seqDB search
MELMWKGLIHQYKEFLPVTDRTPALTLHEGNTPLIHLPKLSEKLGIELHVKTEGVNPTGS
FKDRGMVMAVAKAKEEGNDTIMCASTGNTSAAAAAYAARAGMKCIVIIPDGKIAFGKLAQ
AVMYGAEIIAIDGNFDDALAIVRSICEKSPIALVNSVNPYRIEGQKTAAFEVCEQLGEAP
DILAIPVGNAGNITAYWKGFKEYHEKNGTGLPKMRGFEAEGSAAIVRGEVIKNPETVATA
IRIGNPASWDKAVLAAEESAGKIDEVTDGEILHAYQLIAREEGVFAEPGSCASIAGVLKQ
VKSGEIPKGSKVVAVLTGNGLKDPNTAVDVSDIKPITLPTDEDSILEYLNGAARV
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
ttggagctaatgtggaaaggactcatccatcaatataaagaatttctgccggtgacggat
cggacgccggccctgacattgcatgaaggcaacacgccgctgattcacctcccgaagctt
tctgaaaagctcggaattgaactgcatgtgaaaacagaaggcgttaatccgacgggatct
tttaaagaccgcggcatggtcatggcggtcgccaaagcgaaagaagaaggcaatgatacc
atcatgtgcgcctcaacaggcaacacatccgctgcggctgccgcatacgcggcgagagcc
ggcatgaaatgcatcgtcatcatcccggacgggaaaatcgccttcggaaagcttgcgcag
gccgtcatgtacggtgcggaaatcatcgcgattgacggaaactttgacgacgcgctggcc
atcgtccggtcgatttgtgaaaaatcaccgattgcattagtgaattcagtaaacccttac
cggattgaagggcaaaaaacagcggcctttgaagtatgcgaacagctcggcgaagcgccg
gacattctggcgatcccggtaggaaatgccgggaatatcacggcctactggaaagggttc
aaagaatatcatgagaaaaacggcaccggacttccgaagatgcgcggttttgaagcggaa
ggttctgcggctatcgtccgcggcgaagtcattaaaaatccagaaaccgttgcgacggca
atccggatcgggaatcccgccagctgggacaaagccgtgctcgctgcggaagaatcagcc
ggaaaaattgatgaagtcacagatggagaaatccttcacgcttatcagctgattgcccgt
gaagaaggcgtatttgccgagccgggctcctgtgcatccatcgccggtgttttaaaacag
gtgaaatccggtgaaattccaaaaggaagcaaggttgtcgcagttctgaccggaaacggc
ctgaaagatccgaacacggctgtggacgtatctgacataaaaccgatcacgctgccgaca
gatgaggacagtattctggaatacttaaatggagcggcgcgtgtatga

DBGET integrated database retrieval system