KEGG   Bacillus velezensis CAU B946: BACAU_2965Help
Entry
BACAU_2965        CDS       T01692                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
baq  Bacillus velezensis CAU B946
Pathway
baq00260  Glycine, serine and threonine metabolism
baq00750  Vitamin B6 metabolism
baq01100  Metabolic pathways
baq01110  Biosynthesis of secondary metabolites
baq01120  Microbial metabolism in diverse environments
baq01230  Biosynthesis of amino acids
Module
baq_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BACAU_2965 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BACAU_2965 (thrC)
Enzymes [BR:baq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BACAU_2965 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CCF06499
Position
complement(3174177..3175244)
Genome map
AA seq 355 aa AA seqDB search
MELMWKGLIHQYKEFLPVTDRTPALTLHEGNTPLIHLPKLSEKLGIELHVKTEGVNPTGS
FKDRGMVMAVAKAKEEGNDTIMCASTGNTSAAAAAYAARAGMKCIVIIPDGKIAFGKLAQ
AVMYGAEIIAIDGNFDDALAIVRSICEKSPIALVNSVNPYRIEGQKTAAFEVCEQLGEAP
DILAIPVGNAGNITAYWKGFKEYHEKNGTGLPKMRGFEAEGSAAIVRGEVIKNPETVATA
IRIGNPASWDKAVLAAEESAGKIDEVTDGEILHAYQLIAREEGVFAEPGSCASIAGVLKQ
VKSGEIPKGSKVVAVLTGNGLKDPNTAVDVSDIKPITLPTDEDSILEYLNGAARV
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
ttggagctaatgtggaaaggactcatccatcaatataaagaatttctgccggtgacggat
cggacgccggccctgacattgcatgaaggcaacacgccgctgattcacctcccgaagctt
tctgaaaagctcggaattgaactgcatgtgaaaacagaaggcgttaatccgacgggatct
tttaaagaccgcggcatggtcatggcggtcgccaaagcgaaagaagaaggcaatgatacc
atcatgtgcgcctcaacaggcaacacatccgctgcggctgccgcatacgcggcgagagcc
ggcatgaaatgcatcgtcatcatcccggacgggaaaatcgccttcggaaagcttgcgcag
gccgtcatgtacggtgcggaaatcatcgcgattgacggaaactttgacgacgcgctggcc
atcgtccggtcgatttgtgaaaaatcaccgattgcattagtgaattcagtaaacccttac
cggattgaagggcaaaaaacagcggcctttgaagtatgcgaacagctcggcgaagcgccg
gacattctggcgatcccggtaggaaatgccgggaatatcacggcctactggaaagggttc
aaagaatatcatgagaaaaacggcaccggacttccgaagatgcgcggttttgaagcggaa
ggttctgcggctatcgtccgcggcgaagtcattaaaaatccagaaaccgttgcgacggca
atccggatcgggaatcccgccagctgggacaaagccgtgctcgctgcggaagaatcagcc
ggaaaaattgatgaagtcacagatggagaaatccttcacgcttatcagctgattgcccgt
gaagaaggcgtatttgccgagccgggctcctgtgcatccatcgccggtgttttaaaacag
gtgaaatccggtgaaattccaaaaggaagcaaggttgtcgcagttctgaccggaaacggc
ctgaaagatccgaacacggctgtggacgtatctgacataaaaccgatcacgctgccgaca
gatgaggacagtattctggaatacttaaatggagcggcgcgtgtatga

DBGET integrated database retrieval system