KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_3154Help
Entry
BACAU_3154        CDS       T01692                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BACAU_3154 (tpiA)
   01230 Biosynthesis of amino acids
    BACAU_3154 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BACAU_3154 (tpiA)
   00051 Fructose and mannose metabolism
    BACAU_3154 (tpiA)
   00562 Inositol phosphate metabolism
    BACAU_3154 (tpiA)
Enzymes [BR:baq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BACAU_3154 (tpiA)
Exosome [BR:baq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BACAU_3154 (tpiA)
  Exosomal proteins of bladder cancer cells
   BACAU_3154 (tpiA)
  Exosomal proteins of melanoma cells
   BACAU_3154 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3355320..3356081)
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTLGEAVSFVEEVKSSIPAADKAEAVVCAPALFLEKLTSAVKGTDLK
VGAQNMHFEENGAFTGEISPVALKDLGVDYCVIGHSERREMFAETDETVNKKAHAAFKHG
IVPIICVGETLEEREAGKTNDLVADQVKKGLAGLSEEQVAASVIAYEPIWAIGTGKSSTA
KDANDVCAHIRKVVAESFSQETADKLRIQYGGSVKPANIKEYMAESDIDGALVGGASLEP
QSFVQLLEEGQYE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccaattatagccggtaactggaaaatgaacaaaacactcggcgaagctgtc
agcttcgttgaagaagtgaaatcttccattccagcagcagacaaagcggaagccgttgtt
tgcgcaccagctcttttcttagaaaagctgacttctgctgttaaaggaactgacctgaaa
gtcggcgcccaaaacatgcattttgaagaaaacggtgcgttcacaggtgaaatcagcccg
gtcgctctgaaagaccttggcgtggattactgcgtcatcggccactctgagcgccgtgaa
atgttcgctgaaactgatgaaacagttaacaaaaaagcgcatgccgcttttaaacacggc
attgtgccgatcatttgcgtaggtgaaacgcttgaagagcgcgaagccggaaaaacaaat
gatcttgttgccgatcaagtgaaaaaagggcttgcgggtctttctgaagagcaagtagcc
gcttctgttattgcgtacgagccaatctgggcaatcggaacaggcaaatcttctacagcg
aaagatgcaaacgacgtctgcgcgcatatccgtaaagtcgttgctgaaagcttcagtcag
gaaactgctgacaagctccgcattcaatacggcggcagcgtaaaacctgcaaatattaaa
gaatatatggcagagtccgatattgacggtgctttggtcggcggcgcaagccttgaaccg
cagtcattcgttcaattattggaggaaggtcaatatgagtaa

DBGET integrated database retrieval system