KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_3312Help
Entry
BACAU_3312        CDS       T01692                                 

Gene name
gtaB3
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BACAU_3312 (gtaB3)
   00052 Galactose metabolism
    BACAU_3312 (gtaB3)
   00500 Starch and sucrose metabolism
    BACAU_3312 (gtaB3)
   00520 Amino sugar and nucleotide sugar metabolism
    BACAU_3312 (gtaB3)
Enzymes [BR:baq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BACAU_3312 (gtaB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3518246..3519130
Genome map
AA seq 294 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVESGIEDIIIVTGKG
KRAIEDHFDNAPELERNLEEKGKIELLQKVKKSSNIADIHYIRQKEPKGLGHAVWCARNF
IGDEPFAVLLGDDIVQAEKPGLRQLMDEYEKTLSSIIGVQQVPESDTHRYGIIDPLTNEG
RRYQVKNFVEKPEPGTAPSNLAILGRYVFTPEIFMYLEQQEVGAGGEIQLTDAIQKLNDI
QRVFAYDFEGKRYDVGEKLGFIETTLEFALQDQDIRHKLIPFMKDLLEKEEADE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaagtacgcaaagccattattccggcagcaggtttaggcactcgttttttgccg
gccacaaaagcaatgcctaaagaaatgcttccaatcgttgataagccgacaattcagtat
attatcgaagaagctgtcgaatccggcatcgaagatattattatcgtaaccggaaaagga
aaaagagcaatagaagaccatttcgacaatgcccctgaactggaacgcaatttagaagaa
aaagggaaaatcgaactgcttcaaaaagtgaaaaaatcgtcaaatattgcggatatccac
tatattcgccaaaaagagccaaaaggactcggtcatgccgtttggtgcgcacgcaacttc
atcggcgatgaacctttcgccgttcttctcggcgatgatattgtccaggctgaaaaaccg
ggacttcgtcagctgatggatgaatacgaaaaaacattgtcttccatcatcggtgttcag
caagttcctgaaagcgacacacaccgctacggaattatcgatccgttaacaaatgaaggc
cgccgttaccaggtcaaaaattttgtagagaagcctgaaccgggcacagctccttccaac
ttggctattttaggaagatacgttttcactcctgaaattttcatgtaccttgaacagcag
gaagtcggtgcagggggagaaattcaattaacggacgccatccaaaagctcaatgacatt
cagcgtgtcttcgcttatgatttcgaaggaaaacgttacgatgtcggtgaaaaactagga
tttatcgagacgacgcttgaatttgccttacaggatcaggatatccgccataaattaatt
ccgttcatgaaggatcttcttgaaaaagaagaagctgacgaatag

DBGET integrated database retrieval system