KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_3340Help
Entry
BACAU_3340        CDS       T01692                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BACAU_3340 (rbsK)
Enzymes [BR:baq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BACAU_3340 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3551976..3552857
Genome map
AA seq 293 aa AA seqDB search
MSEICVIGSCSMDLVVTSERRPKAGETVLGTDFQTVPGGKGANQAVAASRLGANVYMVGK
AGSDSYGKAIIENLKANGVNTDYMETVTHKKSGTAHIVLAEGDNSIVVVKGANDDISPDY
AKSALAKLPGIDIVLIQQEIPEETVEEVCSYCRAHQIPVILNPAPARPLKQSTIENAAYL
TPNEHEASILFPDRTKEEALAGYPGKLFITEGKQGVRYSDGTAERLVPGFPAEAVDTTGA
GDTFNAALAVALAEGRDIEQALQFANRAASLSVQHFGAQGGMPVRKEVEELLS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaatttgtgttatcggaagctgttctatggatctggtcgtcacatccgaacgg
cgtccgaaagccggagaaaccgtactgggcacagactttcaaaccgtgcccgggggaaaa
ggcgcaaaccaggccgtagccgcttcccgtctgggcgcaaacgtatatatggtaggaaaa
gctggcagtgacagctacggaaaagcgattattgaaaacctgaaggcaaacggtgtcaat
acggactatatggaaacggttacacataaaaaaagcggaacggctcatattgtgctcgca
gaaggagacaacagcatcgtcgtcgtaaaaggcgcaaacgatgacatctcacccgattat
gccaaaagtgcgctggcaaaacttcccggcattgatatcgtgctgatccagcaggagatt
cctgaagaaaccgttgaagaagtgtgcagctactgccgcgcgcaccaaattccggttatc
ctgaatcccgcgccggcccgcccgctgaaacaatcgacgattgagaatgccgcatatctt
acgccgaacgaacatgaagcatccattttatttcctgaccggacgaaagaagaagcgctc
gccggctatcccggcaaactgttcattaccgaaggaaaacaaggcgtacgctactcagac
ggcaccgcggaacggcttgttcccggcttccctgcagaagcggtcgacacgacgggtgcc
ggcgatacctttaatgcggcacttgccgtcgcactcgcggaaggacgggacatcgagcaa
gcgctccagttcgccaaccgcgccgcctccctgtccgtgcagcacttcggcgcccaaggc
gggatgccggtcagaaaagaagttgaggagctgctgtcatga

DBGET integrated database retrieval system