KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_3426Help
Entry
BACAU_3426        CDS       T01692                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BACAU_3426 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BACAU_3426 (murA)
Enzymes [BR:baq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BACAU_3426 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3627083..3628393)
Genome map
AA seq 436 aa AA seqDB search
MEKIIVRGGQKLNGTVKVEGAKNAVLPVIAASLLASEEKSVICDVPTLSDVYTINEVLRH
LGADVHFENNEVTVNASYALETEAPFEYVRKMRASVLVMGPLLARTGHSRVALPGGCAIG
SRPIDQHLKGFEAMGAKIKVGNGFIEAEVEGRLQGAKIYLDFPSVGATENLIMAAALAEG
TTTLENVAKEPEIVDLANYINAMGGKIRGAGTGTIKIEGVEKLRGVRHNIIPDRIEAGTF
MVAAAITEGNVLVKGAVPEHLTSLIAKMEEMGVKITDEGEGLRVIGPAQLKPIDIKTMPH
PGFPTDMQSQMMALLLRASGTSMITETVFENRFMHAEEFRRMNGDIKIEGRSVIINGPVQ
LQGAEVAATDLRAGAALILAGLVAEGHTRVTELKHLDRGYVNFHKKLAALGADIERVVDE
TAAEQESKEVVTDLNA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaatcatcgtccgcggcggtcagaagttaaacggcacagtgaaagttgaagga
gcaaaaaatgccgttttaccagttatcgctgcatctttattagcaagtgaagaaaaaagc
gtaatatgtgatgtacctacgctctccgatgtatatacaattaatgaagtgttgcgtcat
ttaggagcagatgtgcattttgagaataatgaagttaccgtaaacgcttcttacgcttta
gaaacagaagcaccttttgaatatgtgcgcaaaatgcgcgcgtcagtgcttgttatgggc
cctctgttagctcgtacgggtcattcaagggtagcgcttccgggcggttgcgcaatcggc
tcaagaccgattgatcagcatttaaaaggctttgaagcaatgggtgcaaaaatcaaagta
ggcaacggctttattgaagcagaagtggaaggccgtctgcagggcgcaaaaatctattta
gatttcccaagtgtgggtgcgacagaaaacttgattatggcagctgctttagctgaagga
acaacaacgcttgaaaacgtggcaaaagagcctgaaatcgttgacttagcgaactatatc
aatgcgatgggcggaaaaatccgcggagccggcacaggcaccattaaaattgaaggtgtc
gagaagcttcgcggcgtaagacacaacatcattcctgaccgtattgaagcgggtactttc
atggtggctgcggctatcacggaaggaaatgtattagtcaaaggtgcggttcctgagcat
cttacgtctttaattgcgaaaatggaagaaatgggagtcaaaattacggatgaaggagaa
ggccttcgtgtcatcggtcctgcccagctgaagccgatcgacattaaaacgatgcctcac
ccaggattcccgactgatatgcagtcgcaaatgatggcgctgcttctccgtgcgagcgga
acaagcatgattactgaaactgtgtttgaaaaccgttttatgcatgctgaagaattccgc
cggatgaatggcgacattaaaattgaaggacgttctgtgatcattaacggtcctgtacag
ctgcaaggcgcagaagttgccgctacggacctgcgtgcgggcgcggcgctgattcttgcg
ggattagtggctgaaggtcatacacgcgtcacggaactgaagcacttggatcgcggttat
gtgaatttccataaaaaacttgcggctctcggcgctgacatcgagcgtgtcgttgatgaa
acggccgctgaacaagaaagcaaagaagtcgtaactgacctaaacgcataa

DBGET integrated database retrieval system