KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_3612Help
Entry
BACAU_3612        CDS       T01692                                 

Gene name
ydhP
Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:baq00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3800763..3802163
Genome map
AA seq 466 aa AA seqDB search
MTESNIQYRFPEGFWWGSSASATQTEGAADRDGKSQNIWDYWYEKEPSRFFNGVGPGDTS
CFYDQYKEDIRLMKEIGHNSFRLSISWSRLIPDGTGEVNQKAVAFYQDVIDEMLAHRIEP
FVNLFHFDMPLALQRKGGWVSRDTVDAFEHYAKTCFSLFGDKVKKWFTHNEPIVPIEGGY
LYDFHYPNHVNFQEAVQAGFHTLLSNARAVKAYRELKQDGQIGIILNLTPSYPRSSHPED
LKASRIADAFFNRSFLDPAVKGEFPEELVEILKAEGFLPRYEKEDLRLIQEHTVDLLGVN
YYQPRRVKAKEHVPNPHAPFLPERFFDPYVMPGRKMNPHRGWEIYEKGIYDILTNLREHY
GNIECFISENGMGVEGEERFRDENGIIQDNYRIEFIQEHLKWVHRAIGEGSNVKGYHLWT
FMDNWSWTNAYKNRYGFVSVNLENGGERTVKKSGRWFKAVSDQNGF
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
ttgactgaatcaaatattcaatatcgttttccggaaggattctggtgggggtcttccgcc
tccgccacccaaacagaaggcgccgccgacagagacggaaaaagccaaaacatatgggat
tactggtatgaaaaagagccgagccgtttttttaacggcgtcggccccggcgacacgtca
tgtttttatgatcaatacaaggaggatatccggctgatgaaagaaatcggccacaactcc
ttccggctgtctatttcctggtcaagattgattccggacggaactggcgaggtcaatcag
aaagcggtcgcgttttatcaggacgtcatcgatgaaatgcttgcccatcgcattgagccg
tttgtcaatttgtttcactttgacatgccgcttgcccttcagcgtaaggggggctgggtc
agccgggacaccgttgacgcgtttgaacattacgccaaaacctgcttttcgctattcggt
gacaaagtgaaaaaatggttcactcacaacgagccgattgtgccgattgaaggcggctac
ttatacgactttcactatccgaatcacgttaattttcaagaagcggtgcaggccggcttc
cataccctgctgtcgaatgcaagggctgtcaaagcctacagagaattgaaacaggacgga
caaatcggaatcattctgaatctgacgccttcttatccgagaagctcacaccctgaagat
ctgaaagcatcccggattgccgacgcctttttcaaccgctcatttttagatcccgccgta
aagggcgaatttcctgaggagcttgtcgagattctcaaggcggaaggctttctgccgcgt
tacgagaaagaagatctccgcctcattcaggagcatacggttgacctcttaggcgtgaac
tactaccagccgagacgcgtcaaggcaaaagaacatgttccgaatccgcacgcccctttc
ctgcctgagcgtttcttcgatccgtatgttatgcccggacggaaaatgaaccctcaccgc
gggtgggaaatatacgaaaaaggaatctatgacattctcaccaatctcagagaacattac
ggaaatatcgaatgttttatttccgagaacggcatgggagttgaaggcgaggaacgcttc
cgcgatgaaaacggcatcattcaggataattacaggattgaatttatccaggaacatctc
aaatgggtgcatcgggccatcggagaaggttcaaatgtaaaaggctatcacctgtggact
ttcatggacaactggtcttggacaaatgcttataaaaaccgctacggctttgtatctgtc
aatctggaaaacgggggcgaacggaccgtcaaaaaaagcggccgctggttcaaagccgtt
tccgatcaaaacggattttaa

DBGET integrated database retrieval system