KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_3732Help
Entry
BACAU_3732        CDS       T01692                                 

Gene name
rocF
Definition
(RefSeq) arginase
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BACAU_3732 (rocF)
  Amino acid metabolism
   00220 Arginine biosynthesis
    BACAU_3732 (rocF)
   00330 Arginine and proline metabolism
    BACAU_3732 (rocF)
Enzymes [BR:baq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BACAU_3732 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3932673..3933563)
Genome map
AA seq 296 aa AA seqDB search
MNKNISVIGMPMDLGQARRGVDMGPSAIRYAHLIERLSDMGYAVEDLGDIPVNREKLKHD
EELKNLNSVLSGNEQLAQKVDSVIENERFPLVLGGDHSIAIGTLTGTAKHYKQLGVIWYD
AHGDLNTLETSPSGNIHGMPLAVSLGVGHDTLVNLGGYAPKIKPENVVIIGARSLDEGER
EYIKETGMKVYTMHEIDRLGMTKVIEETIDYLSDCDGVHLSLDLDGLDPSDAPGVGTPVV
GGISYRESHLAMEMLYDADIITSAEFVEVNPILDHKNKTGKTAVELVESLLGKKLL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaatatctcagttattggaatgccgatggatttaggacaagcacgacgcgga
gtggacatgggcccgagcgccatccgctacgcgcatctcattgaacggttatctgacatg
gggtatgcggtggaagacttaggcgacatccccgtcaatcgtgaaaaactcaaacatgat
gaagagctgaaaaatttgaactctgtgctctcggggaacgagcagctcgcccaaaaggtg
gacagcgtcattgagaatgagcggttccctctcgtcttgggcggcgatcacagcattgcg
atcggaacgctgacaggaacggcaaagcactataaacagctcggcgtcatctggtacgac
gcgcacggcgacttaaacaccctggaaacatcgccgtcaggcaatattcacggaatgccg
ctggccgtcagcctcggcgtcgggcacgacacgctggtgaatctgggcggttatgccccg
aaaatcaagccggagaacgtcgtcattatcggcgcgagatcgcttgatgaaggcgagcgt
gaatacattaaggaaacaggcatgaaagtctatacgatgcatgagattgaccgcctcggc
atgacaaaggtcattgaagaaaccattgactacctgtcagactgtgacggcgttcacctc
agccttgatctagacggccttgatccgagcgacgcacccggcgtaggcacgcctgtcgtc
ggcggcatcagctaccgtgaaagccacttggcaatggaaatgctgtatgatgccgacatc
atcacttcagctgaatttgtcgaagtcaacccgatcctcgatcacaaaaacaaaaccggc
aaaacagcggtcgagctggtggaatctttgttaggaaaaaaactattataa

DBGET integrated database retrieval system