KEGG   Bacillus amyloliquefaciens subsp. plantarum CAU B946: BACAU_3732Help
Entry
BACAU_3732        CDS       T01692                                 

Gene name
rocF
Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
baq  Bacillus amyloliquefaciens subsp. plantarum CAU B946
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:baq01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:baq00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3932673..3933563)
Genome map
AA seq 296 aa AA seqDB search
MNKNISVIGMPMDLGQARRGVDMGPSAIRYAHLIERLSDMGYAVEDLGDIPVNREKLKHD
EELKNLNSVLSGNEQLAQKVDSVIENERFPLVLGGDHSIAIGTLTGTAKHYKQLGVIWYD
AHGDLNTLETSPSGNIHGMPLAVSLGVGHDTLVNLGGYAPKIKPENVVIIGARSLDEGER
EYIKETGMKVYTMHEIDRLGMTKVIEETIDYLSDCDGVHLSLDLDGLDPSDAPGVGTPVV
GGISYRESHLAMEMLYDADIITSAEFVEVNPILDHKNKTGKTAVELVESLLGKKLL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaatatctcagttattggaatgccgatggatttaggacaagcacgacgcgga
gtggacatgggcccgagcgccatccgctacgcgcatctcattgaacggttatctgacatg
gggtatgcggtggaagacttaggcgacatccccgtcaatcgtgaaaaactcaaacatgat
gaagagctgaaaaatttgaactctgtgctctcggggaacgagcagctcgcccaaaaggtg
gacagcgtcattgagaatgagcggttccctctcgtcttgggcggcgatcacagcattgcg
atcggaacgctgacaggaacggcaaagcactataaacagctcggcgtcatctggtacgac
gcgcacggcgacttaaacaccctggaaacatcgccgtcaggcaatattcacggaatgccg
ctggccgtcagcctcggcgtcgggcacgacacgctggtgaatctgggcggttatgccccg
aaaatcaagccggagaacgtcgtcattatcggcgcgagatcgcttgatgaaggcgagcgt
gaatacattaaggaaacaggcatgaaagtctatacgatgcatgagattgaccgcctcggc
atgacaaaggtcattgaagaaaccattgactacctgtcagactgtgacggcgttcacctc
agccttgatctagacggccttgatccgagcgacgcacccggcgtaggcacgcctgtcgtc
ggcggcatcagctaccgtgaaagccacttggcaatggaaatgctgtatgatgccgacatc
atcacttcagctgaatttgtcgaagtcaacccgatcctcgatcacaaaaacaaaaccggc
aaaacagcggtcgagctggtggaatctttgttaggaaaaaaactattataa

DBGET integrated database retrieval system