KEGG   Bacillus anthracis Ames 0581: GBAA_0043Help
Entry
GBAA_0043         CDS       T00178                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bar  Bacillus anthracis Ames 0581
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bar00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
48101..48970
Genome map
AA seq 289 aa AA seqDB search
MKLLVKAPAKINLSLDVLGKRQDGYHEVKMIMTTIDLADRLELMELAEDRIEILSHNRYV
PDDQRNLAYQAAKLLKEKFNVKKGVSITIEKTIPVAAGLAGGSSDAAATLRGLNKLWNLG
LTIDQLAELGAEIGSDVSFCVYGGTAIATGRGEQIEHIKTPPSCWVILAKPHIGVFTADV
YGNLKLNRVTHPNVDKMVDVINAGDYKGICDTVGNVLEDVTFAMHPEVARIKAQMKRFGA
DAVLMSGSGPTVFGLVHHDSRMHRIYNGLKGFCEQVYAVRLLGERETLE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctactagtgaaagcaccagcaaagattaatctgtcgttagatgtactgggaaaa
agacaagacggatatcatgaagtgaaaatgattatgacaacaatcgatttagcggatcgt
ttagaactaatggaattagcagaagaccgtattgaaattttatcccataatcggtatgtc
ccagacgaccaaagaaatctggcttatcaagcagcgaaattattaaaagagaagtttaat
gtgaaaaaaggtgtatctattactattgaaaaaacgattccagtagcagctggattagcg
ggtggaagtagtgatgcagcagcgacattacgtggtcttaataaattatggaatttaggc
cttacgattgatcaattagcagagcttggcgcagaaattggatcagatgtatcgttttgt
gtatatggtgggacagcaattgccactggaagaggagagcagattgagcacataaaaact
ccaccttcttgttgggttattttagcaaagcctcatattggtgtatttactgctgatgta
tatggaaatttaaagttaaatcgagttacacatccaaatgtagataaaatggtggatgtc
ataaacgctggagactacaaagggatttgcgatactgttggtaacgttttagaagatgta
acgtttgctatgcatcctgaagttgcacgtattaaagcacaaatgaagcgatttggagca
gatgctgtattaatgagtggaagtggtccaactgtattcggcctagtgcaccatgattcg
cgaatgcatcgtatatataacggattaaaaggattttgtgaacaagtatacgcagtacgt
ttattaggagagcgagaaacgcttgaataa

DBGET integrated database retrieval system