KEGG   Bacillus anthracis Ames 0581: GBAA_0073Help
Entry
GBAA_0073         CDS       T00178                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bar  Bacillus anthracis Ames 0581
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bar00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
78699..79214
Genome map
AA seq 171 aa AA seqDB search
MNNIAYIALGSNIGERYTYLTEAIQFLNKNPYIKVEDVSSVYETEPVGYTDQSCFLNLVI
KISTNLSPQELLKVTQKVENDLGRKREIRWGPRTIDLDILLYNQENIEAENLIVPHPRMF
ERAFVIVPLLEINQDIKQNISRSQVEEMKRREGVTVWKQKNGEDAFVLFEN
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatagcttacattgcattaggttcaaatattggagaacgttatacgtattta
acggaagcgattcagtttctaaataaaaatccttatatcaaagttgaagatgtttcatct
gtatatgaaacggaaccagttggctatactgaccaaagttgctttttaaatttagttata
aaaatttctaccaatttatcaccgcaagaattattgaaagtaacgcaaaaagtagaaaat
gacctaggaagaaaaagggaaattaggtggggccctaggactatcgaccttgacatttta
ctatataatcaagaaaatattgaagcagagaatcttattgttccgcatccgcggatgttc
gaaagagcttttgttatcgttccgttgttagagattaatcaagatataaaacaaaacatt
tcacgttcacaagtagaagaaatgaaaaggcgagagggagtaacggtatggaagcagaaa
aatggggaagacgcattcgtgcttttcgaaaactaa

DBGET integrated database retrieval system