KEGG   Bacillus anthracis Ames 0581: GBAA_0154Help
Entry
GBAA_0154         CDS       T00178                                 

Gene name
rocF
Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bar  Bacillus anthracis Ames 0581
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bar01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bar00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
152603..153496
Genome map
AA seq 297 aa AA seqDB search
MKKEISVIGVPMDLGQMRRGVDMGPSAIRYAGVIERIEEIGYDVKDMGDICIEREKEVDV
NTSLRNLTQVATVCNELASKVDHIIEEGRFPLVLGGDHSIAIGTLAGVAKHYKNLGVIWY
DAHGDLNTEETSPSGNIHGMSLAASLGYGHPTLVDLYGAYPKVKKENVVIIGARALDEGE
KDFIRNEGIKVFTMHEIDRMGMTAVMEETIEYLSHTDGVHLSLDLDGLDPHDAPGVGTPV
IGGLSYRESHLAMEMLAEADIVTSAEFVEVNMILDERNRTATTAVALMGSLFGEKLK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaatttcggttattggagttccaatggatttagggcagatgcgtcgtgga
gttgatatgggaccgagcgcaatccgttatgcaggtgtaattgaaagaattgaagaaatt
ggatatgacgttaaagatatgggagatatatgtatagagagagaaaaagaagtagatgta
aatacaagcttaagaaaccttacacaagttgcaactgtatgtaacgaattagcaagtaag
gtagatcatattatagaagaagggcgttttccacttgtattaggtggcgatcatagtatc
gctattggtacattagctggtgtggcgaaacattataaaaacctaggtgttatttggtac
gatgcacatggtgatttaaatacagaagaaacttcaccatctgggaatattcacggtatg
tcacttgcagcaagtttagggtatggacatcccacgcttgtagatttatacggggcatat
ccaaaggtgaaaaaagagaatgttgtcattatcggtgcacgtgcattagatgaaggagaa
aaagactttattcgcaatgaaggtattaaagtattcacaatgcacgagattgatcgtatg
ggtatgacagctgttatggaagaaacaattgaatatttatctcatactgacggtgtgcat
ttatcattagatttagatggtcttgatcctcatgatgcaccaggagttggaacacctgta
attggtggcctatcttatcgtgagagccatttagcaatggagatgttagcggaagctgat
attgttacatctgcggagtttgttgaggtaaatatgattttagatgagcgaaatagaacg
gcaacaacagcggttgctttaatgggttctttattcggtgaaaaactaaaataa

DBGET integrated database retrieval system