KEGG   Bacillus anthracis Ames Ancestor: GBAA_0499Help
Entry
GBAA_0499         CDS       T00178                                 

Gene name
glsA1
Definition
(GenBank) glutaminase A
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
bar  Bacillus anthracis Ames Ancestor
Pathway
bar00220  Arginine biosynthesis
bar00250  Alanine, aspartate and glutamate metabolism
bar00471  D-Glutamine and D-glutamate metabolism
bar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bar00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GBAA_0499 (glsA1)
   00220 Arginine biosynthesis
    GBAA_0499 (glsA1)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    GBAA_0499 (glsA1)
Enzymes [BR:bar01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     GBAA_0499 (glsA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase TIMELESS
Motif
Other DBs
NCBI-ProteinID: AAT29592
UniProt: Q81YY0
Position
complement(492962..493891)
Genome map
AA seq 309 aa AA seqDB search
MQCIETNNLQQLLEQVKPYTKKGKLATYIPELGNANPDDLGIAIFHKETEYIHAGNSQTL
FTLQSISKVITLALALLDRGEEYVFSKVGMEPTGDPFNSIIKLETTSPSKPLNPMINAGA
LAITSMLAGKDNEEKMERILHFVREITDNPTINYSSKVANSELETAYLNRSLCYYMKQNG
IIDCDIEELMDLYTRQCAVEVNCIDLARIGLIFAMDGYDPYKKKQIIPKHITKICKTFMV
TCGMYNESGEFAIRVGIPAKSGVAGGIFGCVKGEMGIGIFGPALDANGNSIAGFKILELL
SAQEGWSIF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcattgaaacaaacaacttacaacagttgttagaacaagtaaaaccatatacg
aaaaaaggaaagcttgctacttatatccccgaactaggaaatgccaatccagatgattta
gggattgccattttccataaagaaacagaatacatccatgctggcaactcacaaacacta
ttcactcttcaaagtatttcaaaagtaattacacttgcacttgcacttttagatcgtggt
gaagaatatgtattttctaaagttggaatggagccaactggtgatccatttaattctatt
attaagttagaaacgacgagtccttctaaaccacttaatccaatgattaatgcaggggca
ctagctattacaagtatgttagcaggaaaagataacgaagaaaaaatggagcgcattctt
catttcgtacgtgaaataacagataatcctactattaattattcttctaaagttgccaat
tcagaattagagacagcttacttaaatcgttcactttgttactatatgaaacaaaacgga
attatcgattgtgatatcgaagaactgatggatttatacactcgccaatgtgcagttgaa
gtaaactgtattgatttagcacgtatcggtttaatttttgcgatggatggatatgatcca
tataagaaaaaacaaattatccctaagcatattacaaagatttgtaaaacatttatggtt
acatgtggtatgtataacgagtctggtgaatttgcgattcgtgttggtatcccagcaaaa
agtggtgtagctggtggtattttcggctgcgtaaaaggagaaatgggaattggtattttc
ggaccagctttagatgcaaacggaaatagtatcgctggttttaaaattcttgaacttctt
tctgctcaagaaggttggagcattttttaa

DBGET integrated database retrieval system