KEGG   Bacillus anthracis Ames Ancestor: GBAA_1072Help
Entry
GBAA_1072         CDS       T00178                                 

Gene name
hemY1
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
bar  Bacillus anthracis Ames Ancestor
Pathway
bar00860  Porphyrin and chlorophyll metabolism
bar01100  Metabolic pathways
bar01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bar00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GBAA_1072 (hemY1)
Enzymes [BR:bar01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     GBAA_1072 (hemY1)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     GBAA_1072 (hemY1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_9 NAD_binding_8 HI0933_like DUF4988 Pyr_redox_2 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AAT30172
UniProt: D1MPY6
Position
1053241..1054611
Genome map
AA seq 456 aa AA seqDB search
MYHLQKDIRDKNLPIDTLLIEASGKLGGKIQTVRKDGFTIERGPDSFLARKESAARLVKE
LGLGDELVNNQAGQSFILVNNRLHKMPSGSMMGIPTQITPFLFSGLFSPIGKLRAGFDLL
MPRSKPVSDQSLGHFFRHRLGNEVVENLIEPLLSGIYAGDIDEMSLMSTFPQMYQIEQKH
RSISLGMRTLAPKAEKAEPKKGIFQTVKTGLESIVESLELKMHEGTIIKGTRIEKVAKQG
DGYAITLSNGKEIEADAVVVASSHKVLPSMFAQYKQFRFFRNIPSTSVANVAMAFPKSAI
QRDIDGTGFVVSRNSDYTITACTWTHKKWPHTTPEGKTLLRCYVGRPGDEAVVEQTEEEL
VQLVLEDLRKTMDITEDPEFTVVSRWKEAMPQYTVGHNERMKKLTTFMEKELPGIYLAGS
SYAGSGLPDCIDQGEKAAKRVLSHLEKVMNTELIAQ
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacttacaaaaagatattcgtgacaagaacttgccgatcgatacattactgata
gaagcatcgggtaaacttggcgggaaaattcaaaccgttcgaaaagatggatttacaatt
gaacgcggaccggattctttcttagcacgaaaagaaagtgcagctagattagtgaaagaa
ttaggtcttggcgatgagcttgtaaataatcaggccggtcaatcatttatcctcgtaaac
aatcggttacataaaatgccgagcggatcaatgatgggaattccaacgcaaattacgccg
tttctattttctgggctgttctccccaattgggaaactaagagctggttttgatctatta
atgccaagatcaaaaccagtatctgaccaatcactcgggcactttttcagacatcgcctc
ggaaatgaagtggttgaaaatttaatagaaccattactatctggtatttatgcaggggat
attgatgaaatgagcttaatgtcaacattcccgcaaatgtatcaaattgagcagaaacat
cgcagtatttcactcggtatgcgtacgctcgccccgaaagcagagaaagctgaaccgaaa
aagggaatcttccaaacagtgaaaaccggtttagaatctatcgtagaatctctcgaatta
aagatgcatgaaggtacgataataaagggaactcgcatagaaaaagttgcaaaacagggt
gatggctatgcgattactcttagtaacggaaaagaaatagaagcggacgcggtcgtagtg
gcaagctcacataaagtattgccatctatgtttgcgcagtacaagcaatttcgtttcttc
cgcaacattccatccacatcagttgcgaatgtggcaatggctttcccgaaatcagccatt
cagcgggatattgatggtacaggatttgttgtctctcgaaatagtgattacacaattaca
gcatgtacgtggacgcataaaaagtggccacatacaacgccagaaggaaaaacgcttctt
cgatgttacgttggacgacctggtgatgaagcggttgtagaacaaacagaagaggaactc
gttcagctcgtactagaagacttacgaaagacgatggatattacagaggatccagagttt
acagtcgtaagtcgctggaaagaagcaatgccccaatatacagtaggccataacgagcga
atgaagaaactcacaacatttatggagaaagagttgccaggtatatacttggcaggtagt
tcttacgctggttctggtcttccggactgtattgatcaaggtgagaaggctgcaaaacgt
gtactctctcatttggagaaagtaatgaatacggaattaatcgcacaataa

DBGET integrated database retrieval system