KEGG   Bacillus anthracis Ames 0581: GBAA_1229Help
Entry
GBAA_1229         CDS       T00178                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bar  Bacillus anthracis Ames 0581
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:bar00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:bar00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1187910..1188455
Genome map
AA seq 181 aa AA seqDB search
MKVIETNFTDAKLLEPRLFGDDRGFFTESYNKKVLETLGVTHSFVQDNVSYSAEAGTIRG
LHFQKNPKAQTKLIQVMQGAIYDVIVDLRKDSPTFKQWRGYILSADNHRQLLVPKGFAHG
FCTLVPHTIVMYKVDEYYSADHDSGVLWNDKELAIPWPVTSPILSDKDRILPLLQECEDS
F
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttatagaaacaaactttaccgacgcaaaattgttggaaccgaggttatttgga
gatgatcgtggcttttttactgaaagttataataagaaggtgctagaaacattaggggtt
acgcattcatttgtacaggataatgtctcgtattcagcggaagcgggaacgattcgcgga
ttacattttcaaaaaaatccgaaagcacaaacgaaacttattcaagttatgcaaggagca
atctatgacgttatcgtagatttgagaaaggattcaccaacgtttaaacagtggagagga
tatattttaagtgcggataatcatcggcaattattagtgccaaaaggatttgcacatggt
ttttgtacacttgtcccgcatacgattgttatgtataaagtagatgagtattatagtgcc
gatcatgactcaggggtactttggaacgataaagaattagcaattccatggccggtaaca
agtcctattttgtctgataaagatcgaatattaccattacttcaggaatgtgaagatagc
ttttga

DBGET integrated database retrieval system