KEGG   Bacillus anthracis Ames 0581: GBAA_1969Help
Entry
GBAA_1969         CDS       T00178                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bar  Bacillus anthracis Ames 0581
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bar01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bar00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:bar00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1852050..1853108
Genome map
AA seq 352 aa AA seqDB search
MYKGLLNQYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKD
RGMVMAVAKAKEEGSEAIICASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVA
YGAEIISIEGNFDDALKAVRNIAEEEPITLVNSVNPYRIEGQKTAAFEICDQLQRAPDVL
AIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIDEPETIATAIRI
GNPASWSYAVEAAEQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHVQS
GKIKKGETVVAVLTGNGLKDPDIAISSNTLDIASVSNNIEQIKEHIKGVIMS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtataaagggctattaaaccaatatgcttcttatttaccggtaaatgaaaacacacca
gatgtgagcttaatggaaggaaatacaccccttattccgttattaaacatatcaaaacaa
ttagggattcagttatacgggaagtatgaaggagcgaatccgacaggttcttttaaagat
cgaggcatggtaatggctgttgcgaaggcgaaagaagaaggttcggaggcaatcatttgt
gcatcgacaggtaatacatcagcatcggctgccgcatacgcggcacgccttggaatgaaa
tgtattatcgtaataccggaaggaaagattgcacatggaaaattagcacaagcagttgcg
tatggtgctgaaatcatttcaatagaaggaaattttgatgatgcattaaaggctgtaaga
aatatcgctgaggaagagccgattacgttagtaaactcagtgaatccttatcgaattgaa
gggcaaaaaacagcagcgtttgaaatttgtgatcagttgcaacgtgcaccagatgtttta
gcgattcctgttgggaatgccggaaatattacagcgtactggaaaggtttctgtgaatat
gagaaagaaaaaggttataaaaagccaagaattcatgggtttgaagcggaaggagcagct
gcaattgtaaaagggcatgtaattgacgagccagaaacaattgcaactgcgattcgcatc
ggtaacccagcaagttggtcatatgcggtagaggctgctgagcaatctcacggcgaaata
gatatggtatcagatgaagagattttacatgcgtatagattattagcaaaatcggaaggg
gttttcgctgagccaggatcaaatgcttcattagccggtgtaatgaaacatgttcaatct
ggaaaaatcaaaaagggagaaacagttgttgcagttttaactggaaatggcttgaaagat
cctgatatcgcaatttcttctaatacattagatattgcaagtgtttcaaataatatagaa
caaattaaagagcatattaaaggggtgattatgtcgtga

DBGET integrated database retrieval system