KEGG   Bacillus anthracis Ames 0581: GBAA_2119Help
Entry
GBAA_2119         CDS       T00178                                 

Gene name
bsaA
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bar  Bacillus anthracis Ames 0581
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:bar00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bar00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1975109..1975591
Genome map
AA seq 160 aa AA seqDB search
MTVYDFSAKTITGEEKSLKDYEGKVLLIVNVASKCGFTPQYKGLQEVYDKYKEQGLEILG
FPCNQFGGQEPGTEADITSFCELNYGVNFPMFAKIDVKGDKAHPLYTYMTEQAPGLLGMK
AVKWNFTKFLIGKDGKVVGRFAPQTKPVDLEVEIEKVLGE
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacagtgtatgatttttcagctaaaacaataacaggtgaagaaaaatcgttaaaagat
tacgagggaaaagtacttcttattgtaaatgtagctagtaaatgcgggtttacaccgcaa
tataaaggattacaagaagtatatgataaatataaagaacaagggctagaaatactcggt
ttcccatgtaaccaattcggaggacaagaaccaggtacagaagcagatattacaagcttt
tgtgaattaaactacggtgtaaacttcccaatgtttgcaaaaattgatgtaaaaggtgat
aaggctcatcctctgtatacatacatgacagaacaagcaccaggtttactcggtatgaaa
gcagtaaaatggaactttacaaaatttctaattggaaaagacggaaaagtagtaggacgt
tttgcaccgcaaacgaagccggtggatttagaggttgagattgagaaagtacttggtgaa
taa

DBGET integrated database retrieval system