KEGG   Bacillus anthracis Ames 0581: GBAA_2222Help
Entry
GBAA_2222         CDS       T00178                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bar  Bacillus anthracis Ames 0581
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bar00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    GBAA_2222
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GBAA_2222
  Lipid metabolism
   00071 Fatty acid degradation
    GBAA_2222
  Amino acid metabolism
   00350 Tyrosine metabolism
    GBAA_2222
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GBAA_2222
   00626 Naphthalene degradation
    GBAA_2222
Enzymes [BR:bar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GBAA_2222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2075821..2076999
Genome map
AA seq 392 aa AA seqDB search
MPKSVLYGRNSLEKLWEQSKKFGKRAFIVTDTIMEDLGYVERCIQQLNTKGITVITYNKV
NAEPTNIHVLEALTICKEGKCDFIIGLGGGSCIDAAKAVAVLYTNGGEVEDYVQKDREID
NDPLPLIAIPTTSGTGSEVTSVAVITNKRTDVKMMMKHPSFTPQVAIIDPILTRSVPPHI
TAATGIDALCHAVEAYISKVSQSLTDVLALSAIESIMKYLRIAYEDGENMEAREAMMIAS
LQAGIAFSNASVTLVHGMSRPVGALFHVPHGISNAILLPTVLEYTKGSAVKRLAEIGRCL
NKDLYSYCDEEVADYTLGEIKKLCFDLHIPNLKEYGIGELEFEKAISKMASDAIESGSPA
NNPRVPSYDEIKQLYRECFHYKYEDSIKTLGD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagtctgtattatatggaagaaattctcttgaaaagctgtgggaacaatctaag
aaattcgggaaaagagcgtttatagttacggatacaattatggaggatttaggatatgtt
gagaggtgtatacaacaattaaatacgaaaggtataactgttattacatataataaagta
aatgctgagcctacaaatatacacgtgttagaggcgttaactatttgtaaagaaggaaag
tgtgattttataatcggtcttggtggtggaagttgtattgatgcagcaaaagcagttgcg
gtgttatatacaaatggcggagaagtggaagattatgtccaaaaggatagggaaatagac
aatgatccgctaccacttattgcaatcccaacaacctctggaactggatcggaagtaaca
agtgtagcagtaattacgaataaacgaacagatgtaaaaatgatgatgaagcatccgagt
tttaccccgcaagtagcaattattgacccaattttaacacgttcggtaccacctcacatt
acagcagcaacagggatagatgctttatgtcatgcagtcgaagcatatatttctaaagtt
tcacaatcacttacagatgtattagctctttccgctattgaaagtattatgaaatattta
cgtattgcatatgaagatggagagaatatggaggcaagagaagcgatgatgatagcgtcc
ttacaagctggaattgcattttctaatgcatctgttacattagttcatggcatgtcgaga
ccagtaggagcattatttcatgtaccacatggtatatcgaatgcaatactattacctaca
gttttagagtatacaaaaggtagtgcggtaaaaagactagcggaaattggccgctgttta
aataaagatttgtattcctattgtgatgaagaagtagccgactacacgctgggggaaata
aaaaaactttgttttgatcttcatattccaaatttaaaagaatacggaattggtgagctt
gagtttgaaaaagctatttctaaaatggcgtcagatgcaattgaaagtggaagtccagcg
aataacccacgtgtgccatcatatgatgaaattaaacagttgtatcgagaatgttttcat
tataaatatgaagattcaataaaaacattaggggattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system