KEGG   Bacillus anthracis Ames 0581: GBAA_2237Help
Entry
GBAA_2237         CDS       T00178                                 

Gene name
dfrA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bar  Bacillus anthracis Ames 0581
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bar00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GBAA_2237 (dfrA)
   00670 One carbon pool by folate
    GBAA_2237 (dfrA)
Enzymes [BR:bar01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     GBAA_2237 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
2088967..2089455
Genome map
AA seq 162 aa AA seqDB search
MIVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRN
IIVTRNEGYHVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHA
FEGDTFFPEMDMTNWKEVFVEKGLTDEKNPYTYYYHVYEKQQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgatagtttcatttatggtcgcaatggacgaaaatagagtaattggtaaagataataat
ttaccttggcgtttaccgagtgaattgcagtatgtaaagaaaacaacgatgggtcacccg
cttattatgggaagaaaaaactatgaagcgattggtagaccactgcctggaagacgtaat
attattgtaactcgcaatgaaggatatcatgttgaaggctgtgaagtagcacattctgta
gaagaagtgtttgagctatgcaaaaatgaagaagagatctttatttttggcggagcacaa
atttatgatctctttttaccttacgtagacaagttatatataacaaaaatccatcatgca
tttgaaggagatacatttttcccagaaatggatatgacaaattggaaagaagtttttgtt
gaaaaaggtttaacggatgaaaaaaatccgtatacgtattattaccatgtatatgagaaa
caacaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system