KEGG   Bacillus anthracis Ames Ancestor: GBAA_2267Help
Entry
GBAA_2267         CDS       T00178                                 

Definition
(GenBank) putative alcohol dehydrogenase, zinc-containing (EC:1.1.1.1)
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bar  Bacillus anthracis Ames Ancestor
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bar00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    GBAA_2267
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GBAA_2267
  Lipid metabolism
   00071 Fatty acid degradation
    GBAA_2267
  Amino acid metabolism
   00350 Tyrosine metabolism
    GBAA_2267
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GBAA_2267
   00626 Naphthalene degradation
    GBAA_2267
Enzymes [BR:bar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GBAA_2267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2112287..2113324
Genome map
AA seq 345 aa AA seqDB search
MKAVVVNKNSKANIEVVEKELRPLHSGEALVDVEYCGVCHTDLHVANHDFGNTDGRILGH
EGVGIVTKIADDVTSLKVGDRVSIAWMFQSCGRCEYCVTGRETFCREVKNAGYSVDGGMA
EQCIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSDIKPGQPIVIYGCGGLGNLAI
QYAKNVFGAKVIAVDINDDKLALAKEVGADMTINPISQGPADKIIQEEFGGAYAAVVTAV
SKVAFNSAVDAVRACGKVVAVGLPVETMDLNIPRLVLDGIEVVGSLVGTRKDLEEAFMFG
AEGKVVPVVQTCSLDKVQNVFEEMEQGRIQGRMVIDFKQNNCDCK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtagtagttaataaaaatagtaaagccaatattgaggttgttgaaaaggaa
ttacgtccgctacactcaggtgaagcactagtagatgtagagtattgtggggtttgtcat
actgatttacacgttgcaaatcatgattttggaaacacagatggccgtattcttggtcat
gagggtgtaggtattgtgacgaaaatcgctgatgatgttacttcactaaaggtaggtgat
cgtgtaagtattgcatggatgttccaatcttgtggacgttgtgaatattgcgtgactggt
agagaaacattttgccgtgaagttaagaatgctggttattcagtagatggtggtatggct
gaacaatgtattgttacagctgattatgcagtgaaagtaccagaaggattagatcctgct
caagcatcatcgatcacatgtgcgggcgttactacatataaagctataaaagtatctgat
attaaacctggtcaaccgatcgtaatctatggttgtggtggattaggtaacttagctatc
caatatgctaaaaatgtatttggtgcaaaggtaattgcagtagatattaatgacgataaa
ctagccttagcaaaagaggttggtgctgatatgacaatcaatccaatttctcaaggtcct
gctgataagattattcaagaggagtttggtggtgcttatgctgctgtagtaacagctgtt
tcaaaggtagcattcaactcagcagttgacgcagtacgtgcttgtggtaaagtcgttgca
gtaggtttaccagtagaaactatggatttgaacattccgcgccttgtactagatggaatt
gaagtagttggttctttagtcggtactcgtaaggatctagaagaggcgtttatgttcggg
gcagaaggaaaagtagtgccagttgttcaaacttgttctttagataaagtacaaaatgta
ttcgaagaaatggaacaaggtagaattcaagggcgtatggtaatcgattttaaacagaac
aattgtgattgcaaataa

DBGET integrated database retrieval system