KEGG   Bacillus anthracis Ames 0581: GBAA_2418Help
Entry
GBAA_2418         CDS       T00178                                 

Gene name
hemY-2
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bar  Bacillus anthracis Ames 0581
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bar00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2253937..2255337
Genome map
AA seq 466 aa AA seqDB search
MKTVVVIGGGITGLSTMFYLEKFKKDNNIDLNLILVEKEEYLGGKIHSVEEKDFIMESGA
DSIVARNEHVMPLVKDLNLEGEMVYNETGISYIYSDNTLHPIPSDTIFGIPMSVESLFSS
TLVSTKGKIVALKDFITKNKEFTKDTSLSLFLESFLGKELVERQIAPVLSGVYSGKLNEL
TMASTLPYLLDYKNKYGSIIKGFEENKKQFQSAGNKKFVSFKGGLSTIIDRLEEMLTETV
VKKGAVTTAVSKQGDRYEISFANHDSIHADYVVLAAPHDIAETLLQSNELNEQFHTFKNS
SLVSIYLGFDILDEQLPADGTGFIVTENSDLHCDACTWTSRKWKHTSGKQKLLVRMFYKS
TNPVYETIKNYSEEELVRVALYDIEKSLGIKGEPEVVEVTNWKDLMPKYHLEHNQALQTL
QEKMMNLYPNIYLAGASYYGVGIGACIGNGKNIANEIIATLNEPSN
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggttgttgttatcggtggaggtataacgggactttctactatgttttattta
gaaaaattcaaaaaggataataatatcgatttaaatttaatccttgtagaaaaagaagag
tacttaggtggtaaaatccatagtgtagaagaaaaggattttattatggaatcaggagcg
gattctattgttgcacgtaatgaacatgttatgccacttgtaaaagatttaaatttagaa
ggagaaatggtatataacgagacgggtatttcttacatatattctgataatactttacat
ccaattccgtctgacactatatttgggataccgatgagtgtcgagtcgttgtttagcagt
acgctagtatcaacgaaggggaaaattgttgctttaaaagattttataacgaaaaataaa
gagtttacaaaagatacatccctttccctatttttagaaagctttttagggaaagaatta
gtagaaagacaaattgcgccagtgctttcaggtgtatattctggtaaattgaacgagctt
acaatggcatctacattaccatatttactggactataaaaataaatatggaagtattatt
aaaggttttgaagagaataaaaaacagtttcaatcagcaggaaacaaaaagttcgtatca
tttaaaggtggattatctacgattattgatcgtttagaagaaatgctgactgagacggtt
gttaagaaaggtgctgtaacgacagctgtaagcaaacaaggtgatcgctatgaaatctct
tttgcaaatcacgattcaatccacgctgattatgttgttttagcagctccgcatgatatc
gcagaaactttattacagtctaatgagttaaacgaacagtttcatacatttaaaaactca
tctcttgtaagtatttacttaggatttgacatactagatgaacaattaccggcggacggt
acaggatttatcgtaacggaaaacagtgatttacattgtgatgcttgtacatggacaagc
cggaagtggaaacatacatctggaaaacaaaaactattagtgagaatgttttataagagt
actaatccagtatatgaaacgattaaaaattatagtgaagaagaattagtacgggttgct
ttatatgatattgaaaagagtctcggaattaaaggtgaaccagaagtagttgaagtgaca
aattggaaagatttaatgccgaaatatcatttagaacataatcaagcgcttcaaacatta
caagaaaaaatgatgaatctttaccctaatatatacttagctggcgcttcctattatggt
gttggtattggtgcgtgtattggaaatggaaagaacattgcaaatgaaatcattgcaaca
ttaaatgaaccatcaaattaa

DBGET integrated database retrieval system