KEGG   Bacillus anthracis Ames 0581: GBAA_3409Help
Entry
GBAA_3409         CDS       T00178                                 

Gene name
dxr-1
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bar  Bacillus anthracis Ames 0581
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bar00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3133763..3134920
Genome map
AA seq 385 aa AA seqDB search
MVKYISILGSTGSIGTSALDVVSAHPEHFKIVGLTANYNIELLEQQIKTFQPRIVSVATK
ELADTLRTRISTNTKITYGTDGLIAVATHPNSNLVLSSVVGVSGLLPTIEALKAKKDIAI
ANKETLVAAGHIVTELAKQNGCRLIPVDSEHSAIFQCLNGENNKEIDKLIVTASGGAFRD
KTREEMKTLQAKDALKHPNWLMGAKLTIDSATLMNKGFEVMEARWLFDIPYEKINVMIHK
ESIIHSLVEFIDGSVIAQLGAPDMRMPIQYAFHYPTRLPSSYEKLNLLEIGSLHFEKPDL
EKFPCLQYAYECGKIGGITPAVLNAANEIANALFLKNEIAFFDIEKTIYKTVEAHHNVKD
PSLDAILEADQWARQYANQLLIKKS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaatatatatccattttaggttcaacaggatccatcggcacatcggcattagat
gtcgtttcagctcatcccgaacattttaaaatcgtcggtttaaccgcaaattataatatc
gagcttcttgaacaacaaatcaaaacgtttcaacctcgcattgtaagcgtcgcgacaaaa
gaattagcagacacgcttcgtacgcgtatttcaaccaacacaaaaatcacatacggaaca
gatggcttaattgcagtagctactcaccctaattcaaatcttgtattaagttccgtcgtt
ggtgtttcaggattactcccaacaattgaagcattaaaagcgaagaaagatattgccatc
gctaataaagaaacgttagttgcagctggtcatattgtaactgaactggccaaacaaaac
ggatgtcgtttaattccagtcgatagcgaacattcagctattttccaatgtttaaacgga
gaaaataataaagaaattgacaaattaatcgttacagcttctggcggtgcattccgtgat
aaaacacgtgaagaaatgaaaactctacaagcaaaagatgctttaaagcacccaaactgg
ttaatgggggcaaaactaacgattgattctgccacgttaatgaataaaggatttgaagta
atggaagcgagatggttatttgatattccttatgaaaaaattaatgtaatgattcataaa
gaaagcattattcattctttagtagagtttatcgatggatcagttatagcacagctcggt
gctcctgatatgaggatgccgattcaatatgcgtttcactaccctactcggctgccttct
tcctatgaaaaattaaatttattagaaatcggtagtttacattttgaaaaaccagattta
gagaagtttccttgtctacaatacgcatatgaatgtggcaaaattggtggtattactcct
gctgtattaaacgcagcaaatgaaattgcgaatgcactattcttaaaaaatgaaattgcc
tttttcgatattgaaaaaacaatttacaaaacagttgaagcccatcataacgtaaaagat
ccttcactagatgctatattagaagcggatcaatgggcacgccaatatgcaaatcaattg
ttaataaaaaagagctaa

DBGET integrated database retrieval system