KEGG   Bacillus anthracis Ames Ancestor: GBAA_3876Help
Entry
GBAA_3876         CDS       T00178                                 

Definition
(GenBank) putative phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bar  Bacillus anthracis Ames Ancestor
Pathway
bar00010  Glycolysis / Gluconeogenesis
bar00260  Glycine, serine and threonine metabolism
bar00680  Methane metabolism
bar01100  Metabolic pathways
bar01110  Biosynthesis of secondary metabolites
bar01120  Microbial metabolism in diverse environments
bar01130  Biosynthesis of antibiotics
bar01200  Carbon metabolism
bar01230  Biosynthesis of amino acids
Module
bar_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bar_M00002  Glycolysis, core module involving three-carbon compounds
bar_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GBAA_3876
  Energy metabolism
   00680 Methane metabolism
    GBAA_3876
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GBAA_3876
Enzymes [BR:bar01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     GBAA_3876
Membrane trafficking [BR:bar04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    GBAA_3876
Exosome [BR:bar04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   GBAA_3876
  Exosomal proteins of melanoma cells
   GBAA_3876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF1482
Motif
Other DBs
NCBI-ProteinID: AAT32990
UniProt: Q81WU1
Position
complement(3545806..3546381)
Genome map
AA seq 191 aa AA seqDB search
MNTYIYMVRHGESPKLDGGERTRGLTEKGSLDVHKVTDILKTEGIDTFISSPYKRAVLTI
EKTANLYEREILIYENLKECMFSSGDQVISDKEVYPLVQKMFSNPGYALAEGESYADCQR
RVVKVLKEILMDFQGQKIVIGTHGLVMTLMMNYFDKQYGFEFLMNTSKPDIYKMEFKEKQ
LMNVERLWKAE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaatacatatatttatatggttagacacggtgaatcaccaaaattagatgggggtgaa
agaacacgtggtttaactgaaaagggaagtttagacgttcataaagtaacagatatatta
aaaacagagggaatcgatactttcatttcaagtccgtataagagggctgtattaacgata
gaaaaaacagctaatctctatgaaagagaaatattaatatatgaaaaccttaaagagtgt
atgttttccagtggggatcaagttatatcagataaagaagtgtatccgcttgtacagaaa
atgttctctaatcctggctatgcactagcggaaggagagtcatatgcggattgccagaga
agagtagtgaaagtgttaaaagaaatattaatggattttcaaggacaaaaaattgtaatt
ggtacacatggtcttgtcatgacattaatgatgaactatttcgataaacaatatggtttt
gaatttttaatgaatacgtcaaaaccagatatatataagatggagtttaaagaaaaacaa
ttaatgaatgtagagagattatggaaagcggaataa

DBGET integrated database retrieval system