KEGG   Bacillus anthracis Ames Ancestor: GBAA_3959Help
Entry
GBAA_3959         CDS       T00178                                 

Gene name
dxr2
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bar  Bacillus anthracis Ames Ancestor
Pathway
bar00900  Terpenoid backbone biosynthesis
bar01100  Metabolic pathways
bar01110  Biosynthesis of secondary metabolites
bar01130  Biosynthesis of antibiotics
Module
bar_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bar00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GBAA_3959 (dxr2)
Enzymes [BR:bar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     GBAA_3959 (dxr2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Semialdhyde_dh NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AAT33073
UniProt: Q81WL4
Position
complement(3637026..3638168)
Genome map
AA seq 380 aa AA seqDB search
MKNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSVGKNIDYAVKVIQEFSPQIVSVQREE
DVLKLQAVSGNTKIVYGSEGLLEVALHPDAEIVVNAVVGSVGLLPTLRAIEAKKTIGIAN
KETLVTAGHLVMEAARKHNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFRDKT
RDELHHVTVEDALRHPNWSMGSKITIDSATMMNKGLEVIEAHWLFGIPYEQIDVVLHKES
IIHSMVEFEDRSVMAQLGSPDMRVPIQYALTYPDRLPLSDTKQLNLWEIGTLHFEKMNQE
RFRCLRFAYEAGKAGGSMPAVMNAANEVAVEAFLQKRIGFLTVEDLIEKAMNHHNVIARP
SLEEILEIDAATRRFVMEQI
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacattagtttattaggtgcaagcggatcaattggtacacaaactttagatgta
ttacgctcgcacccagaccaattccgtctcgttgctttttctgtagggaaaaatattgac
tacgcagtaaaggtcattcaagaattttctccacaaattgtctctgtgcaaagagaggaa
gatgttttaaaattacaagctgtttctggtaatacaaaaattgtatatggtagtgaaggg
cttttagaagtagcattacatccagatgcggagattgtagtaaacgctgttgtaggtagc
gtagggttgttaccaacacttcgtgcaattgaggcgaaaaaaacaattggaattgcaaac
aaagaaacgttagtaactgcagggcatcttgtaatggaagcagcgcgaaaacataatgtt
tcgttacttccagtagacagtgaacattcagctatttttcaatgcttgaatggtgaaaat
gaaaaaagaatttctcgactaattataacggcttctggtggaagtttccgtgataaaacg
agagatgaattgcatcatgtgaccgtagaagatgcgcttcgacatccaaactggtcaatg
ggttcgaaaattacaattgattctgctacaatgatgaataaggggctagaagtaattgaa
gcacattggctttttggtatcccttatgagcaaatcgatgttgttttacataaagaaagt
attattcattctatggttgaatttgaagatcgtagtgtgatggcacagcttggctcacct
gatatgcgagtaccaattcaatacgcgcttacatatcctgatcgattacctctttcagac
acaaagcagttaaacttatgggaaataggaacgttgcattttgagaagatgaaccaagaa
cgtttccgttgcctacgttttgcgtatgaagctggaaaagcaggtggaagtatgccagct
gtaatgaatgcagcgaatgaagtagctgttgaagcttttttacaaaagagaattggtttc
ttaacagtggaagacctcattgaaaaagcaatgaaccatcacaatgtcattgcacgtccg
agcttagaggaaattctggaaattgatgcagccacaagacggtttgtgatggaacaaatt
tag

DBGET integrated database retrieval system