KEGG   Bacillus anthracis Ames Ancestor: GBAA_4182Help
Entry
GBAA_4182         CDS       T00178                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase complex E2 component, dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bar  Bacillus anthracis Ames Ancestor
Pathway
bar00010  Glycolysis / Gluconeogenesis
bar00020  Citrate cycle (TCA cycle)
bar00620  Pyruvate metabolism
bar01100  Metabolic pathways
bar01110  Biosynthesis of secondary metabolites
bar01120  Microbial metabolism in diverse environments
bar01130  Biosynthesis of antibiotics
bar01200  Carbon metabolism
Module
bar_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GBAA_4182 (pdhC)
   00020 Citrate cycle (TCA cycle)
    GBAA_4182 (pdhC)
   00620 Pyruvate metabolism
    GBAA_4182 (pdhC)
Enzymes [BR:bar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GBAA_4182 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H NUP50
Motif
Other DBs
NCBI-ProteinID: AAT33302
UniProt: Q81MR3
Position
complement(3828941..3830200)
Genome map
AA seq 419 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFIKPGDEVNEDDVLLEVQNDKAVVEIPSPVKGKVLEVL
VEEGTVAVVGDTLIKFDAPGYENLKFKGDDHDEAPKAEATPAATAEVVNERVIAMPSVRK
YARENGVDIHKVAGSGKNGRIVKADIDAFANGGQAVAATEAPAAVEATPAAAKEEAPKAQ
PIPAGEYPETREKMSGIRKAIAKAMVNSKHTAPHVTLMDEVDVTELVAHRKKFKAVAADK
GIKLTYLPYVVKALTSALREYPMLNTSLDDASQEVVHKHYFNIGIAADTDKGLLVPVVKD
TDRKSIFTISNEINDLAGKAREGRLAPAEMKGASCTITNIGSAGGQWFTPVINHPEVAIL
GIGRIAEKPVVKNGEIVAAPVLALSLSFDHRLIDGATAQKALNQIKRLLNDPQLLVMEA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaactaccagatatcggtgaaggtatccacgaaggtgaaatcgta
aaatggtttattaaaccaggcgacgaagtaaacgaagacgacgtacttcttgaagtacaa
aatgataaagcagtagtagaaattccttctcctgttaaaggtaaagtacttgaagtactt
gtagaagaaggtacggttgcagtagttggagatacattaattaaatttgatgctccagga
tacgaaaaccttaaatttaaaggcgacgatcatgacgaagctcctaaagctgaagctact
ccagcagcaactgcagaagtagtaaatgagcgcgtaatcgctatgccatctgttcgtaaa
tatgctcgtgaaaacggcgtagacattcataaagtagctggttctggtaagaacggtcgt
atcgtaaaagctgacatcgatgcatttgcaaatggtggacaagcagtagcagcaactgag
gctccagcagcagtagaagctactccagcagcagcgaaagaagaagcaccaaaagcacaa
ccaatcccagctggtgaatatccagaaactcgtgagaaaatgagtggtatccgtaaagca
attgcgaaagcaatggttaactctaaacatacagctcctcacgtaacattaatggatgaa
gtagatgtaactgaacttgttgctcaccgtaagaagttcaaagctgtggcagctgacaaa
ggtattaaattaacttaccttccatacgttgttaaagctttaacatctgcattacgtgaa
tacccaatgttaaacacttctttagatgatgcttctcaagaagtagttcataaacattac
ttcaacatcggtatcgcagctgatacagacaaaggtctattagtaccagttgttaaagat
acagatcgcaagtctatcttcacaatttctaacgagatcaatgatcttgctggtaaagca
cgtgaaggtcgtttagctcctgctgaaatgaaaggcgcttcttgcacaattacaaacatt
ggttctgcaggtggacaatggttcactccagttatcaaccacccagaagtagcaatcctt
ggtatcggccgtatcgctgagaaaccagttgtgaaaaacggtgagatcgttgcagctcca
gtattagcattatctctaagctttgaccatcgtttaattgacggcgcaactgctcaaaaa
gcattaaaccaaattaaacgtctattgaatgacccacaattattagtaatggaggcgtaa

DBGET integrated database retrieval system