KEGG   Bacillus anthracis Ames Ancestor: GBAA_4240Help
Entry
GBAA_4240         CDS       T00178                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bar  Bacillus anthracis Ames Ancestor
Pathway
bar00071  Fatty acid degradation
bar00072  Synthesis and degradation of ketone bodies
bar00280  Valine, leucine and isoleucine degradation
bar00310  Lysine degradation
bar00362  Benzoate degradation
bar00380  Tryptophan metabolism
bar00620  Pyruvate metabolism
bar00630  Glyoxylate and dicarboxylate metabolism
bar00640  Propanoate metabolism
bar00650  Butanoate metabolism
bar00900  Terpenoid backbone biosynthesis
bar01100  Metabolic pathways
bar01110  Biosynthesis of secondary metabolites
bar01120  Microbial metabolism in diverse environments
bar01130  Biosynthesis of antibiotics
bar01200  Carbon metabolism
bar01212  Fatty acid metabolism
bar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bar00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GBAA_4240
   00630 Glyoxylate and dicarboxylate metabolism
    GBAA_4240
   00640 Propanoate metabolism
    GBAA_4240
   00650 Butanoate metabolism
    GBAA_4240
  Lipid metabolism
   00071 Fatty acid degradation
    GBAA_4240
   00072 Synthesis and degradation of ketone bodies
    GBAA_4240
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GBAA_4240
   00310 Lysine degradation
    GBAA_4240
   00380 Tryptophan metabolism
    GBAA_4240
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GBAA_4240
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GBAA_4240
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GBAA_4240
Enzymes [BR:bar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GBAA_4240
Exosome [BR:bar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GBAA_4240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AAT33357
UniProt: Q81MK7
Structure
PDB: 

Jmol
Position
complement(3881394..3882569)
Genome map
AA seq 391 aa AA seqDB search
MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRT
DEANTARTAALAAGFPDTVTGYTIQRQCSSGMQAIMSAAMQIQLGVSEVVVAGGVEAMSS
SPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETAENLVEQYEITREEQDEVALR
SHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV
TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLE
KVDWSLEDADLLEINEAFAAQYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSL
IHELKRRGLEKGIASLCVGGGIGVALFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgttgttattacagctgcagttcgttcgccaattggaacttttgggggagcg
ctaaaaaatgtaacgccagtagaattagctgttcctgtacttcaggaagctgtaaaacga
ggcggggtagaaccacacgaagtggatgaagtgattttaggtcattgtattcaaagaact
gatgaagcaaatacggcgagaacggctgcattagcggcaggatttcctgacacagttacg
ggctatacaatccaacgccaatgttcttcaggtatgcaagcaattatgtcggctgcaatg
caaattcaattaggtgtaagtgaagttgttgttgcaggtggagtagaagcaatgagttca
agcccctatgcattgaaacaacaccgctggggacaacgcctacaacacggagaaattcgt
gatacggtgtgggaagtgttagaagatccgattcatcatattatgatgggggaaacagcg
gaaaatttagttgaacaatatgaaattacaagagaggaacaagatgaagttgcgcttcgc
agtcatacattggcactgaaggcaatcgagtctggatactttgacgatcaaattgttcct
attacaataaaagaacgtagaaaagaagtagtattttcgaaggatgaacatccacgtgct
gatattacagcagaaaaattagctgggttaaaaccagctttccgtaaagatggatctgta
acggcagggaatgcatctggcctgaatgacggaagcgcggttctagtattaatgagcgaa
gaaaaagcgaaagaaaaaggcttacaaccgttagctagaattgttggatattcagtagct
ggagtagatccaaaaattatggggattggaccagcaccagcaattcgtaaaggattagaa
aaagtagattggtcattagaagatgcagatttactggaaattaatgaagctttcgctgca
caatacttagctgtagagaaagaattaggtttagatcgtgaaaaagtgaatgtaaatggt
agtggtgtaggacttggacatccaattggttgtacaggagctcgtattactgtaagttta
attcatgaattaaaaagacgcgggttagaaaaaggaattgcctctctatgcgtcggcggc
ggtattggagtagcattatttatagaagcactataa

DBGET integrated database retrieval system