KEGG   Bacillus anthracis Ames 0581: GBAA_4761Help
Entry
GBAA_4761         CDS       T00178                                 

Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bar  Bacillus anthracis Ames 0581
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bar00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    GBAA_4761
  Lipid metabolism
   00071 Fatty acid degradation
    GBAA_4761
Enzymes [BR:bar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GBAA_4761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4328872..4329648)
Genome map
AA seq 258 aa AA seqDB search
MLKFLSVRVEDHIAVATLNHAPANAMSSQVMHDVTELIDQVEKDDNIRVVVIHGEGRFFS
AGADIKEFTSVTEAKQATELAQLGQVTFERVEKCSKPVIAAIHGAALGGGLEFAMSCHMR
FATESAKLGLPELTLGLIPGFAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGLVNGV
FAEETFLDDTLKVAKQIAGKSPATARAVLELLQTTKSSHYYEGVQREAQIFGEVFTSEDG
REGVAAFLEKRKPSFSGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaattcctatctgtaagagttgaagatcatatcgcggtggctacgttaaatcat
gcgccagctaacgcgatgtcttcgcaagttatgcatgacgttactgaattaattgatcaa
gtggagaaggatgataatattcgtgttgttgttattcatggtgaagggcgcttcttctcg
gcgggagcagatattaaagaatttacatctgttactgaagcgaagcaagcgactgaatta
gcgcagcttggacaagttacgtttgagcgcgttgaaaaatgttcaaaaccagttatcgcg
gcaattcatggagcggcacttggcggcggccttgagtttgctatgtcttgccacatgcgc
tttgcaactgaaagcgcaaaacttggtttacctgaattaacacttggattaattcctgga
tttgcaggtacacagcgattaccacgttatgttgggaaagcgaaagcttgtgaaatgatg
ttaacaagtacaccgattactggtgcagaagcattaaaatggggactagttaacggagtt
tttgctgaagaaacatttttagatgatacgcttaaagttgcaaaacagattgctggaaaa
agcccagcgacggcccgtgctgtactagagttattgcaaacgacgaaatcgtctcattat
tatgagggtgtacaacgcgaagctcaaatctttggtgaagtatttacgagtgaagatgga
agagaaggtgtagcagcatttttagaaaagcgtaagccttcatttagtggcaggtag

DBGET integrated database retrieval system