KEGG   Bacillus anthracis Ames Ancestor: GBAA_4844Help
Entry
GBAA_4844         CDS       T00178                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bar  Bacillus anthracis Ames Ancestor
Pathway
bar00010  Glycolysis / Gluconeogenesis
bar00030  Pentose phosphate pathway
bar00051  Fructose and mannose metabolism
bar00052  Galactose metabolism
bar00680  Methane metabolism
bar01100  Metabolic pathways
bar01110  Biosynthesis of secondary metabolites
bar01120  Microbial metabolism in diverse environments
bar01130  Biosynthesis of antibiotics
bar01200  Carbon metabolism
bar01230  Biosynthesis of amino acids
bar03018  RNA degradation
Module
bar_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GBAA_4844 (pfkA)
   00030 Pentose phosphate pathway
    GBAA_4844 (pfkA)
   00051 Fructose and mannose metabolism
    GBAA_4844 (pfkA)
   00052 Galactose metabolism
    GBAA_4844 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    GBAA_4844 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    GBAA_4844 (pfkA)
Enzymes [BR:bar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GBAA_4844 (pfkA)
Protein phosphatases and associated proteins [BR:bar01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GBAA_4844 (pfkA)
Messenger RNA biogenesis [BR:bar03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GBAA_4844 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Peripla_BP_1 NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AAT33963
UniProt: Q81KZ0
Position
complement(4408127..4409086)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDI
IHRGGTKLYTARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLADGAETILIPEEEYDMEDVIARLKRGSERGKKHSIIVVAEGVGSAIDIGKHIEEATNF
DTRVTVLGHVQRGGSPSAQDRVLASRLGARAVELLIAGKGGRCVGIQDNKLVDHDIIEAL
AQKHTIDKDMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattggtgtattaacaagtggtggagattcacctggtatgaatgctgccatt
cgtgcagttgttcgtaaagcgattttccatgatattgaagtatatggtatttaccatgga
tacgctggattaatttctggtcacattgaaaaattagaactaggttctgttggcgatatt
atccaccgcggtggtacgaaattatatacagcaagatgtcctgagtttaaagacccagaa
gtacgactaaaaggtatcgagcaattaaagaaacacggtatcgaaggacttgttgttatt
ggtggagatggttcttaccaaggcgctaaaaaattaactgaacaaggattcccttgtgtt
ggtgtaccaggtacaattgacaatgatatccctggaacagacttcacaattggtttcgat
acagctttaaacactgttattgatgcaattgataaaattcgtgacacagctacatctcat
gaacgtacatatgttatcgaagtaatgggacgtcacgctggtgatatcgcattatgggct
ggtttagctgatggtgcagaaacaatcttaattccagaagaagagtatgacatggaagat
gttatcgctcgtctgaagcgcggtagtgaacgtggtaaaaaacacagtattatcgttgta
gctgaaggtgttggaagtgcaattgacatcggtaagcacattgaagaagcaacaaacttt
gatactcgcgtaactgtattaggtcacgtacaacgtggtggatcaccaagtgcacaagac
cgtgtattagcaagccgtcttggcgcaagagcagttgaattattaattgctggtaaaggt
ggacgttgtgtaggtattcaagataacaaacttgttgatcatgacattatcgaagcgtta
gctcaaaagcatacaatcgataaagatatgtatcaattatctaaagaattatccatctaa

DBGET integrated database retrieval system