KEGG   Bacillus anthracis Ames 0581: GBAA_5009Help
Entry
GBAA_5009         CDS       T00178                                 

Definition
hypothetical protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bar  Bacillus anthracis Ames 0581
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bar00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    GBAA_5009
Enzymes [BR:bar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     GBAA_5009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4547063..4547866)
Genome map
AA seq 267 aa AA seqDB search
MWNYEAEEAKAVIVIVHGAMEYHGRYEAVAEMWNHIGYHVVMGDLPSHGTTSRNRGHIDS
FDEYIEEVKLWVKEARKYRLPIFLFGHSMGGLIVIRMMQETKREDVDGIILSSPCLGVLA
GPSAPLQAASKILNIIAPKLQFATNLTVEMSTRNHEVRDAMENDSLFLRKVSVRWYSELI
KSIEIAHKKIDDFPDVPLLLMQACEDKLVDKTRVRTWFNNVKISDKAFKEWPNCYHELLN
EYERDEILNYIQSFTEIRINNIIETNK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtggaattatgaagctgaagaagcaaaggctgtaatcgttatcgtgcacggcgcaatg
gaatatcacggacgctatgaagccgttgcggaaatgtggaatcatatcggctaccatgtc
gtgatgggggaccttccgtcacatggaacgacttcaagaaatagaggacatattgattcg
tttgatgaatacatagaggaagttaaattatgggtgaaagaggcaagaaagtatcggtta
cctatttttctatttggtcatagtatgggtggtcttattgtcattcgtatgatgcaagaa
acgaagagagaagatgtagacggcattattttaagttcgccatgtttaggtgtattagct
ggaccttctgcaccgcttcaagctgcctcaaaaatattaaatattatcgctccgaagtta
caatttgcaacgaatcttacagtggaaatgtcaacgcgtaatcatgaagtgagagatgcg
atggagaacgattcattgttcttgcgcaaagtatcagtacgttggtatagtgaattgatt
aagtctattgaaatcgctcataaaaaaatagatgattttccagatgttccgctcttgcta
atgcaagcatgtgaggataaacttgtagataaaacacgtgtccgcacttggtttaataat
gttaaaataagtgataaggcttttaaagaatggccgaattgttatcatgagttattaaat
gagtatgagcgtgatgaaattttgaattatattcagtcatttactgaaatacgcatcaat
aacataatagaaacaaataagtaa

DBGET integrated database retrieval system