KEGG   Bacillus anthracis Ames Ancestor: GBAA_pXO1_0129Help
Entry
GBAA_pXO1_0129    CDS       T00178                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bar  Bacillus anthracis Ames Ancestor
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bar00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GBAA_pXO1_0129
   00052 Galactose metabolism
    GBAA_pXO1_0129
   00500 Starch and sucrose metabolism
    GBAA_pXO1_0129
   00520 Amino sugar and nucleotide sugar metabolism
    GBAA_pXO1_0129
Enzymes [BR:bar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GBAA_pXO1_0129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
pXO1:112567..113454
Genome map
AA seq 295 aa AA seqDB search
MKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVSSGIEDIIIVSGRGK
HVIEDHFDKSYELEQTLFKKNKIKTLEDIECISNLANIHYIRQKEPKGLGHAIYCARRFI
GEEPFAVLLGDDIVSSTYPCLKQLIDVYEEHHCSVVGVQRVLETEVSKYGIVKSANQNVN
QSIIPISMLVEKPPLETAPSNLAIMGRYILKPDIFEVLKNLPVGSGGEIQLTDAINVLNK
QQKVLAFEFDGKRYDVGDKFGFIKATIDFALQRESLKEDVLSYLRNITRDKLINK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgaagattagaaaagcgattatcccagcagcgggattaggcacaagatttttacccgca
acaaaagcacaacctaaagaaatgttgccaattgtagataagccaactattcaatatatt
gttgaagaagctgttagctcaggaatagaggatattattattgtaagtgggagagggaag
catgttatagaagatcattttgataaatcttatgagctagaacaaactttatttaagaaa
aacaaaataaagactcttgaagacattgaatgcatttctaatttagcgaatatccattat
attcggcaaaaagaacctaaaggattaggacatgctatatattgtgctagacgttttata
ggtgaagaaccttttgcagttttacttggtgatgatattgttagctctacgtatccatgt
ctcaagcaattgatagatgtttatgaggaacatcactgttcagtggtaggtgttcaaagg
gtattagaaacagaagtgtctaaatatggaatagttaaatcggcaaatcaaaatgttaat
caatctattattcctatttctatgctagttgaaaaaccacctctggaaactgcaccttca
aatttagctataatgggcagatatatactaaaaccagatatttttgaggtgttaaaaaat
ttacctgtcggatcaggtggagaaattcagttaaccgatgcaatcaatgttttaaataaa
caacaaaaagtactcgcctttgaatttgatgggaaaagatatgatgtaggggataaattt
ggctttattaaagcgactatagattttgcacttcagagagaaagtctaaaagaagatgtt
ttgagttatttgagaaatatcactcgagataaacttatcaataaataa

DBGET integrated database retrieval system