KEGG   Buchnera aphidicola Sg (Schizaphis graminum): BUsg267Help
Entry
BUsg267           CDS       T00087                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bas  Buchnera aphidicola Sg (Schizaphis graminum)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bas00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BUsg267 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BUsg267 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BUsg267 (trpB)
Enzymes [BR:bas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BUsg267 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(302920..304119)
Genome map
AA seq 399 aa AA seqDB search
MTLLNPYFGKFGGMYVPQILMPALYQLEKNFVDAKKDSNFQKSFFNYLKNYAGRPTPLTL
CNNLTNGTKTRIYLKREDLLHGGAHKTNQVLGQAMLAVKMKKKEIIAETGAGQHGVAAAI
ASALFNLKCKIYMGYKDIKRQSPNVFRMKLMGAEVVSVESGSGTLKDACNEALRDWSRNY
QKSHYMIGTAAGPHPYPTIVKEFQKMIGEEAKKQILEQENRLPDAIIACVGGGSNAIGIF
SDFIDEDVNLIGVEPAGQGIETGKHGAPLNHGRTGIYFGMKSHLMQSQEGQIEKSWSISA
GLDFPSVGPEHSWLNSIHRAKYVSITDIEALEAFQILSKKEGIIPALESSHALAYALKLM
YLDPKKEQVFIVNLSGRGDKDIFTVREILKKTEKKHESL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgactttacttaatccttattttggcaaatttggaggtatgtatgttcctcaaatatta
atgccagctttatatcaattagaaaaaaattttgttgacgcaaaaaaagattcaaatttt
caaaaaagtttttttaactatttaaagaattatgctggaagaccaactccgctcacttta
tgtaataatttaactaatggtacaaaaacacgtatttatcttaaaagagaagacctatta
catggaggagctcataaaactaatcaggtattaggacaagcaatgttagcagtaaaaatg
aaaaaaaaagaaataattgctgaaactggtgctggtcaacatggtgttgctgctgctatt
gcttctgcattatttaatttaaaatgtaaaatttatatgggttacaaagatataaaaaga
caaagtccgaatgtttttcgtatgaaattaatgggagcagaagtcgtatcagtagaaagt
ggatcaggaacattaaaagatgcatgcaatgaagctttacgtgattggtctagaaattat
caaaaatcacattatatgattggtactgctgcaggtccacatccctatcccacaattgta
aaagaatttcaaaaaatgattggagaagaggcaaaaaaacaaattctagaacaagaaaat
agattaccagatgcaataattgcttgtgtaggtggtgggtctaatgcaattggtattttt
tctgactttatagatgaagacgtgaatttaattggtgtggaaccagctggtcagggtata
gaaacaggaaaacatggagcaccattaaatcatggtagaacaggtatttattttggaatg
aaatcacatttaatgcaaagtcaagaaggtcaaatagaaaaatcttggtctatttctgct
ggtttagattttccttctgttggtcctgaacattcttggttaaatagtattcatcgtgct
aaatatgtatccattactgatatagaagctttagaagctttccaaattttatctaaaaaa
gaaggtattattcctgcactagagtcttctcatgcattagcttatgcattaaaattaatg
tatctagatcctaaaaaagaacaagtatttattgtgaatctttctggacgtggagacaaa
gatatatttacagttcgtgagattttaaaaaaaacggaaaaaaaacatgagtcgttataa

DBGET integrated database retrieval system