KEGG   Buchnera aphidicola Sg (Schizaphis graminum): BUsg293Help
Entry
BUsg293           CDS       T00087                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bas  Buchnera aphidicola Sg (Schizaphis graminum)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BUsg293 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BUsg293 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BUsg293 (sucB)
Enzymes [BR:bas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BUsg293 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
336668..337849
Genome map
AA seq 393 aa AA seqDB search
MNRINILVPDLPESVNDAVVVKWYKKIGEQISSEDNIVDIETDKVMLEVSAPCNGILNEI
LEKEGSIVKSNQILGNIVESKNIESKTKSKLEKSNKYFIKDKNFNISFKEKIYNFPPSIR
RIIRIKKNKEIFNELNYIKNQENIIEEKLNDQSFSNEKEKKIYENRIKMTRLRQKIAERL
LETKNNTAMLTTFNEVNMQPIISLRKKYGEFFEKKHGVRIGFMPFFVKAVVESLKKFPEI
NASIDKNDIVYYKNIDVSIAVSTPRGVITPVLRNADNMSMADIEKKIKEFSIKGIENKIK
IEELIGGNFTITNGGIFGSLMSTPIINPPQSAILGMHLIKERPMAINGKVKILPMMYLAL
SYDHRLIDGKESVSFLVTIKNILEDFNRIIINV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaataaatattcttgttcctgatttacctgaatctgttaacgatgcagtagtt
gtaaaatggtataaaaaaataggagaacaaatttcttctgaagataatatagtagatatt
gaaacagataaagtaatgctagaagtgtctgctccatgtaatggaatattaaatgaaatt
ttagaaaaagaaggttcaattgttaaatcaaatcaaatattaggaaacattgttgaatca
aaaaatattgaaagtaaaacaaaatcaaaactggaaaaaagtaataaatattttataaaa
gataaaaattttaatatttcttttaaagaaaaaatatacaattttccaccttctataaga
cgtataataagaattaaaaaaaacaaagaaatatttaatgaattaaattatatcaaaaat
caagaaaacataattgaagaaaaattaaatgatcaatctttttctaatgaaaaagaaaaa
aaaatttatgaaaatagaataaaaatgacgcgattgcgtcaaaaaattgctgaaagatta
ttagaaactaaaaataatacagctatgcttactacctttaatgaagtaaacatgcaacca
ataatatcattacgaaaaaaatatggcgaattttttgaaaaaaaacacggtgtccgaatc
ggatttatgcctttttttgtcaaagcagtagtggaatccttaaaaaagtttccagaaata
aatgcctctattgataaaaatgatattgtttattataaaaatattgatgttagtattgct
gtttctactccgagaggagtaataacaccagttttaagaaatgcagataatatgagcatg
gctgatatagaaaaaaaaataaaagaattttctattaaaggtattgaaaataaaataaaa
attgaagaattaattggaggaaattttactataacgaatggcggtattttcggttcttta
atgtctacacctattattaatccacctcaatctgctatattaggcatgcatcttattaaa
gaacgtcctatggctatcaatggaaaagtaaaaatccttcctatgatgtatttagcattg
tcttacgatcatcgactaatagatggaaaagaatctgtgagttttttagtaactataaaa
aacatattagaagactttaatcgaattataattaatgtataa

DBGET integrated database retrieval system