KEGG   Buchnera aphidicola Sg (Schizaphis graminum): BUsg294Help
Entry
BUsg294           CDS       T00087                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bas  Buchnera aphidicola Sg (Schizaphis graminum)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BUsg294 (gpmA)
   01230 Biosynthesis of amino acids
    BUsg294 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BUsg294 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BUsg294 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BUsg294 (gpmA)
Enzymes [BR:bas01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BUsg294 (gpmA)
Exosome [BR:bas04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BUsg294 (gpmA)
  Exosomal proteins of melanoma cells
   BUsg294 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
338021..338713
Genome map
AA seq 230 aa AA seqDB search
MKTNKLVLIRHGQSKWNKLNKFTGWHDIELSDNGINEALKAGSLLKKEKFFFDYAHTSML
KRAIHTLRYILDTLDQSWLPVQKSWRLNERHYGALEGLNKDEMISKYGEEQVNLWRRSFE
IIPPQIRLNDKRFPGNDIRYSNIDNNELPLGESLELTAKRVIPYWNKFILPQIKKRNRVL
IVAHGNSLRALIQFLNKIDNKKILELNIPTATPIILEFNEEYNSIKWYYL
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactaataaattagtcttaattagacatggtcaaagtaaatggaataaattaaat
aaatttactggatggcatgatatagaattaagtgacaatggtataaatgaagctctaaaa
gccggttctctcttgaaaaaagaaaaattttttttcgattatgcacatacttctatgtta
aaaagagcaatacatactttaagatatattttagatacattagatcaatcttggttacca
gttcaaaaatcttggcgtttaaatgaaagacattatggtgcattggagggattaaataaa
gatgaaatgatttcaaaatacggtgaagaacaagtaaatttatggagacgaagttttgaa
attataccacctcaaatcagattaaatgataaaagatttccaggaaatgatatacgttat
tcgaatatagataacaatgaacttccgttaggtgaaagtttagaattgactgcaaaaaga
gtgattccttattggaataaatttattttaccacaaataaaaaaaagaaatagagttctt
attgtagcacatggaaattctctacgtgcattaattcaatttttaaataaaatagataat
aaaaaaattttagaattaaacattccaactgcaacgccaattatcctagaattcaatgaa
gaatataattctattaaatggtattatttataa

DBGET integrated database retrieval system