KEGG   Buchnera aphidicola Sg (Schizaphis graminum): BUsg295Help
Entry
BUsg295           CDS       T00087                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bas  Buchnera aphidicola Sg (Schizaphis graminum)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BUsg295 (pfkA)
   01230 Biosynthesis of amino acids
    BUsg295 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BUsg295 (pfkA)
   00030 Pentose phosphate pathway
    BUsg295 (pfkA)
   00051 Fructose and mannose metabolism
    BUsg295 (pfkA)
   00052 Galactose metabolism
    BUsg295 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BUsg295 (pfkA)
Enzymes [BR:bas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BUsg295 (pfkA)
Protein phosphatases and associated proteins [BR:bas01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BUsg295 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
338920..339882
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRTALSEKLEVFGIYDGYLGLYENRMTLLDRYSVSD
MINRGGTFLGSARFPGFYKNEIRTIAVNNLNKRNIDALVVIGGDGSYIGAQKLTKMGIPC
ISIPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVLPEIHYKKEELVSEIQAGIEKGKKHAIVAITEYICDVEKLAKYIEKKTN
RETRATILGHIQRGGAPVVYDRILASRMGAYAVELLIEGYKGKCVGIQNEKMVFNDITDA
LKNMKRVFKKDWLITAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaagatcggagtattaactagtggtggagatgctcctgggatgaatgctgcg
attagaggtgtagtaagaacagcattgagtgaaaaattagaagtatttggtatttatgat
ggatatttaggtctatatgaaaatcgtatgacattgttagatagatatagtgtttctgat
atgattaatagaggcggaacatttttaggatctgctcgatttcctggcttttacaaaaat
gaaatacgtactattgcagtaaataatttaaataaaagaaatatagatgctcttgttgtt
atcggcggtgatggatcttatataggagcacaaaaattaacgaaaatgggaattccatgt
attagtattccaggtacaatagacaacgatgtagcaggtactgattacacgataggttat
tttacagccttagagacagtggttgaagcgattgatagattaagagatacttcttcttct
catcaaagaatttctattgtagaagttatggggcgatactgcggagatttaacattagct
gctgcaatagcaggtggttgcgaatttattgttcttccagaaattcattataaaaaagaa
gaattggtttctgaaattcaggcaggaatcgaaaaagggaaaaaacatgcaatagtcgca
ataacagaatatatttgtgatgtagaaaaattagcgaaatatattgagaagaaaaccaat
agagagacaagagctacaattttaggacatatccagagaggaggagcaccagtagtatat
gatagaattcttgcttcaagaatgggagcatatgcagtagaattgctgatagaaggctac
aaagggaaatgtgttggaatacaaaatgaaaaaatggtatttaacgacataacagatgcg
ttaaaaaatatgaaacgtgtttttaaaaaagattggttaattacagctaaaaagttatac
taa

DBGET integrated database retrieval system