KEGG   Buchnera aphidicola Sg: BUsg295Help
Entry
BUsg295           CDS       T00087                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bas  Buchnera aphidicola Sg
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:bas01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bas01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bas00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bas00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bas00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism
Metabolism; Energy metabolism; Methane metabolism [PATH:bas00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
338920..339882
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRTALSEKLEVFGIYDGYLGLYENRMTLLDRYSVSD
MINRGGTFLGSARFPGFYKNEIRTIAVNNLNKRNIDALVVIGGDGSYIGAQKLTKMGIPC
ISIPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVLPEIHYKKEELVSEIQAGIEKGKKHAIVAITEYICDVEKLAKYIEKKTN
RETRATILGHIQRGGAPVVYDRILASRMGAYAVELLIEGYKGKCVGIQNEKMVFNDITDA
LKNMKRVFKKDWLITAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaagatcggagtattaactagtggtggagatgctcctgggatgaatgctgcg
attagaggtgtagtaagaacagcattgagtgaaaaattagaagtatttggtatttatgat
ggatatttaggtctatatgaaaatcgtatgacattgttagatagatatagtgtttctgat
atgattaatagaggcggaacatttttaggatctgctcgatttcctggcttttacaaaaat
gaaatacgtactattgcagtaaataatttaaataaaagaaatatagatgctcttgttgtt
atcggcggtgatggatcttatataggagcacaaaaattaacgaaaatgggaattccatgt
attagtattccaggtacaatagacaacgatgtagcaggtactgattacacgataggttat
tttacagccttagagacagtggttgaagcgattgatagattaagagatacttcttcttct
catcaaagaatttctattgtagaagttatggggcgatactgcggagatttaacattagct
gctgcaatagcaggtggttgcgaatttattgttcttccagaaattcattataaaaaagaa
gaattggtttctgaaattcaggcaggaatcgaaaaagggaaaaaacatgcaatagtcgca
ataacagaatatatttgtgatgtagaaaaattagcgaaatatattgagaagaaaaccaat
agagagacaagagctacaattttaggacatatccagagaggaggagcaccagtagtatat
gatagaattcttgcttcaagaatgggagcatatgcagtagaattgctgatagaaggctac
aaagggaaatgtgttggaatacaaaatgaaaaaatggtatttaacgacataacagatgcg
ttaaaaaatatgaaacgtgtttttaaaaaagattggttaattacagctaaaaagttatac
taa

DBGET integrated database retrieval system