KEGG   Buchnera aphidicola Sg (Schizaphis graminum): BUsg297Help
Entry
BUsg297           CDS       T00087                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bas  Buchnera aphidicola Sg (Schizaphis graminum)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BUsg297 (tpiA)
   01230 Biosynthesis of amino acids
    BUsg297 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BUsg297 (tpiA)
   00051 Fructose and mannose metabolism
    BUsg297 (tpiA)
   00562 Inositol phosphate metabolism
    BUsg297 (tpiA)
Enzymes [BR:bas01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BUsg297 (tpiA)
Exosome [BR:bas04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BUsg297 (tpiA)
  Exosomal proteins of bladder cancer cells
   BUsg297 (tpiA)
  Exosomal proteins of melanoma cells
   BUsg297 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(340759..341523)
Genome map
AA seq 254 aa AA seqDB search
MKKKIIAANWKLNGSIKTISYFLTFLKSQISSFLKNNIIIIAPPTVFLERVYKDINSINI
HLAAQNIDVNLTGAFTGENSALMMKDIGVKYIIIGHSERRLLHNENNEIIAKKFCLVKNL
NLVPILCIGETEAEKKSNKTEKILKEQLNSIFNSFGEKAFRNAVIAYEPIWSIGTGVSAD
PKNVQLIHKFIKNYIKKYDIVSAENLIVQYGGSVTSLNAGNFLKQPDIDGLLIGSASLKH
EEFLKIIKISDSFL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaaattattgcagctaattggaaattaaatggtagtataaaaactatttct
tattttttaacttttttaaaatcacaaatttcatcttttttaaaaaacaatattattata
attgcacctccgactgtatttttagaaagagtatacaaagatataaatagtataaatatt
catcttgctgcacaaaatatagatgtaaatctaacaggtgcatttactggtgagaactct
gctttaatgatgaaagatattggtgttaaatatattattattggtcattctgaaagacgt
ttacttcataatgaaaacaatgaaatcattgcgaaaaaattttgtttagtaaaaaatttg
aatttagtgcctattttatgtataggtgaaactgaagcagaaaaaaaatctaacaaaact
gaaaaaattttaaaagaacaattaaattctatatttaattctttcggagaaaaagcattt
agaaatgcagttattgcatatgaacctatttggtctattggaacaggtgtttcagcggat
cctaaaaatgtacaactgatacataaatttataaaaaattatataaaaaaatatgacatt
gtcagtgcagaaaatttgattgtacaatatggaggttctgttacttcattaaatgcagga
aattttcttaaacaacctgatattgatggattattaatcggtagtgcatctttaaaacat
gaagaatttttaaaaattataaaaatatcagatagttttttataa

DBGET integrated database retrieval system