KEGG   Buchnera aphidicola Sg (Schizaphis graminum): BUsg312Help
Entry
BUsg312           CDS       T00087                                 

Gene name
zwf
Definition
glucose-6-phosphate 1-dehydrogenase (EC:1.1.1.49)
Orthology
K00036  
glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49]
Organism
bas  Buchnera aphidicola Sg (Schizaphis graminum)
Pathway
Pentose phosphate pathway
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BUsg312 (zwf)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BUsg312 (zwf)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BUsg312 (zwf)
Enzymes [BR:bas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BUsg312 (zwf)
Exosome [BR:bas04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BUsg312 (zwf)
  Exosomal proteins of colorectal cancer cells
   BUsg312 (zwf)
  Exosomal proteins of bladder cancer cells
   BUsg312 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
357259..358731
Genome map
AA seq 490 aa AA seqDB search
MIIETNQACDLVIFGTKGDLARRKLLPALYKLEKSQKIHPDTRIIGTGRADWNTEDYIKI
VKKAIKMFLNEKIDEKIWKKLRSRLNFFYIDVFQDLHFLELKNILNQKKNIIIYYCAVPS
NTFNAIFTGLGKVNLNSFPSRIIIEKPLGVSLETSKKINNQIAKYFLESQIFRIDHYLGK
ESILNLLALRFSNSFFFHSWNNKIIDHIQITVSEEVGIENRWNYFDQMGQTRDMVQNHLL
QILTIVSMDKPKNITPEGIRDEKLKILRSLKKIDLNEIHIKTARGQYASGIINGKKVPSY
IEENGANKHSKTETFVSIKVDINNDRWFGVPFYLRTGKRLAYKYSEIVIVFKKISKNLFQ
EFNKNLSPNKLIIRLEPNESIKIYFLNKVPGLSKEYKLKSDKMEFNFNINNTKNFVDAYE
RLLFESMRGIQSLFVCREEVEEAWKWIDPIINGWKKTNINTVQLYKSGTWGPKSSDEIIM
RDGRFWETFN
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgattatagaaactaatcaagcttgcgatctagtgatttttggaacaaaaggagattta
gcaagaagaaaattgttaccagctttatataaattagaaaaatctcaaaaaatacatcca
gatacacgtataattggtacaggtcgtgctgattggaatacagaagattatataaagata
gtaaaaaaagcaataaaaatgtttttaaatgaaaaaattgatgaaaaaatttggaaaaaa
ttacgttcacgtttaaattttttttatattgatgtatttcaagatcttcactttttagaa
ttaaaaaatatattaaatcaaaaaaaaaacattattatttattattgtgcagttccttca
aatacatttaatgctatttttacaggattaggaaaagttaatttaaattcttttccatca
agaatcataatcgaaaaaccactcggtgtatctttagaaacatcaaaaaaaatcaataat
caaattgctaaatattttttagaatcgcaaatctttcgtattgatcactatcttggaaaa
gaatcaatattaaatcttttagcattacgtttctcaaattcatttttttttcatagttgg
aataataaaattattgatcatattcaaattactgtatctgaagaagttggtattgaaaat
agatggaattattttgatcaaatgggacaaacacgagatatggtacaaaatcatctcctg
caaattcttacaatcgtttctatggataaaccaaaaaatattacacctgaaggcataaga
gatgaaaaattaaaaatattgcgttctcttaaaaaaattgacttaaatgaaattcatatt
aagacagcacgaggtcaatatgcatctggaattataaatggtaaaaaggtaccttcttac
atagaagaaaatggtgcaaacaaacatagtaaaacagaaacatttgtttcaattaaagtt
gatattaataatgatcgatggtttggagttccattttatttaagaacgggtaaacgttta
gcatataaatactctgaaatagttattgtctttaaaaaaatatctaagaacttgtttcaa
gaattcaataaaaatttatcacctaacaaattgattatacgtctagaacctaatgaaagt
attaaaatatattttttaaataaagtaccaggactcagtaaggaatataaattaaaaagt
gataaaatggaatttaattttaatataaataatactaaaaattttgtcgacgcttatgaa
aggctattatttgaaagtatgagaggaatacaatcattatttgtatgtcgagaagaagta
gaagaagcgtggaaatggattgatccaataataaacggttggaaaaaaacaaatataaat
actgtacagttatataaatctggtacatgggggccaaaaagttcggacgaaatcattatg
cgagatggtcgattttgggaaacatttaattaa

DBGET integrated database retrieval system