KEGG   Buchnera aphidicola Sg: BUsg357Help
Entry
BUsg357           CDS       T00087                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bas  Buchnera aphidicola Sg
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bas00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bas00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
408001..408936
Genome map
AA seq 311 aa AA seqDB search
MRNSLYKKNIISISDLNQNELELVLKKSAFLKVKAQPNLLKNKIIASCFFEASTRTRLSF
ETAVHRLGASIIGFSDGSNISLGKKGETLSDTISVISSYVDAIIIRHPQEGSARLAAQFS
NGVPIFNAGDGANQHPTQTLLDLFTIKETQNKLNNLNIAMVGDLKYGRTVHSLTQALAKY
KNNQFFFVSPDSLTMPNYINDMLYKKEIHWKRYKNIEEIISEIDILYMTRVQKERLDSTE
YASAKSKFVLQTSTLKNARNNLKILHPLPRIDEIDNNVDFTPYAWYFKQAANGIYARQAI
LSLVLIEKHFE
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaattctctatataaaaaaaatataatttcaattagtgatcttaatcaaaatgaa
ttagagttagtattaaaaaaatcagcttttctaaaagtaaaagcacaacctaatttatta
aaaaataaaattattgccagttgtttttttgaagcatcaacacgtactcgtttatctttc
gaaactgctgttcatcgtttaggagcatcaataataggattttctgatggatcaaatatt
tctttaggaaaaaaaggcgaaactttatcagacactatttcagttataagttcatatgta
gatgcaattattattagacatccccaagaaggatcagcacgtttagccgcacaattttct
aatggagtcccaatatttaacgcaggagacggagctaatcaacaccctacacaaacactt
ttagatttatttaccatcaaagaaacacaaaacaagcttaataatttgaatattgctatg
gtaggagatttaaaatatggaagaacagttcattcattaacacaagcattggccaagtat
aaaaataatcaatttttttttgtttcacctgattcattaactatgccaaattatattaat
gacatgctttataaaaaagaaattcattggaaaagatataaaaatatagaagaaataatt
tctgaaattgatattctttatatgactcgtgttcaaaaagaaagacttgattcgactgaa
tatgcaagtgctaaatcaaaatttgtattacaaacttctactttaaaaaatgcacgtaat
aatttaaaaatattacatccactacctcgtatagacgaaatagataacaatgttgacttc
acaccttatgcttggtattttaaacaagcagcaaatggaatttatgcacgtcaagcaatt
ttatcattagtattaatagaaaaacattttgaataa

DBGET integrated database retrieval system