KEGG   Buchnera aphidicola Sg (Schizaphis graminum): BUsg440Help
Entry
BUsg440           CDS       T00087                                 

Gene name
recD
Definition
exodeoxyribonuclease V 67 kDa polypeptide
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bas  Buchnera aphidicola Sg (Schizaphis graminum)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bas00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BUsg440 (recD)
Enzymes [BR:bas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BUsg440 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
502034..503842
Genome map
AA seq 602 aa AA seqDB search
MNMSHLLQNFANKKIITLVDFYFSQFISKKNSIIMLISACVSFESKNGHIFLPIEYFEKN
CFFSISNKQFINKILKCLNKKKINWSLELSEHISCGDGSIITPLVFYKDKIYLYKIWKAE
KKILERLYEKNQFDTIDTQQCLNILNNLFSKKKHDLQKIAVILTLINNIIFITGGPGTGK
TTIILKIIIALIKNAKKKIKIQLSAPTGKATENLIEILNDKWLNRYLLKEEKKQFSFNPI
MTIHQLLGISKKSEKIFFNKNNLLMIDILIIDEASMIDILMMSNILSALSKKTKIIFIGD
HNQLKPVKSSSILKYICSYAEDGYSLKTQSILQEITQNSIINYKINKKNTSYISDKICVL
KKSYRFEKKTGIYILSNAVYNKETKIFEKLFKNSIENVFFYEINSEIEYKKMINIIINNN
KIFWRKIYEKKNIKEIIKTFKNHQILCIVKNGFFGVNFINKILEEEMYKRNIFNKRFYIN
NKLWYIGKPIIITENNQCLGIFNGEIGITNLSQKNTLQVSFLKKDNFIENIPIEILKNYK
TSWSITVHKAQGSEFNNISLILPNKNLKILKKDILYTGITRTRKQLNIFSTKEIFIKTVL
KN
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgtctcatttattacaaaatttcgcaaataaaaagattataactttagttgat
ttttatttttcgcagtttatttcaaaaaaaaattctattattatgttaatatctgcttgt
gtaagttttgaaagtaaaaatggtcatatttttttaccaattgaatattttgaaaaaaac
tgctttttttctatctcaaataaacaattcattaataaaattttaaaatgtttaaataaa
aagaaaataaattggtcattagaattgtcagaacatatatcttgcggagatggttccatc
ataactcctttagtattttataaagataaaatatatctttataaaatatggaaagctgaa
aaaaaaatattagaacgtttatatgaaaaaaatcaatttgatacaattgatacacaacaa
tgtttaaatatactaaataatttattttctaaaaaaaaacatgatcttcaaaaaatagct
gtaatattaactttaataaataacattatttttataactggaggacctggaactggtaaa
actactataatattaaaaattattattgctttaataaaaaatgcaaaaaaaaaaataaaa
attcaattgtcagcgccaacaggaaaagctacagaaaatttaatagaaatattgaatgat
aaatggttgaatcgttatcttcttaaagaagaaaaaaaacaattttctttcaaccctata
atgactatacatcagttattaggaatttcaaaaaaatctgaaaaaattttttttaacaaa
aacaacctgctaatgatagatattttaattattgatgaagcatctatgatagatatttta
atgatgagtaatatattgtcagcactttcgaaaaaaactaaaataatttttattggagac
cacaatcaattaaaaccagtaaaatcaagttctattttgaaatatatttgtagttatgct
gaagatgggtacagtttaaaaactcaatctattttacaagaaattacacaaaattcaata
ataaattataaaataaataaaaaaaatacttcttatataagtgataaaatatgtgttctg
aaaaagagctatcgatttgaaaaaaaaactggaatatatatattatcaaatgcagtttat
aataaagaaacaaaaatttttgaaaaattattcaaaaactcgatagaaaacgtttttttc
tatgaaatcaattctgaaatagaatataaaaaaatgattaatattattattaataataat
aaaatattttggagaaagatatacgaaaaaaaaaatataaaagaaataataaaaaccttt
aaaaaccatcaaatattatgtattgtaaaaaacggtttttttggtgtaaattttataaat
aagattttagaagaagaaatgtataaaagaaatattttcaataaacgcttttatataaat
aataagttatggtatataggaaaacctattataattacagaaaataatcaatgtctagga
atatttaatggtgaaataggtataactaatcttagtcaaaaaaataccttacaggtatct
tttttaaagaaagataattttattgaaaatattcccatagaaatattaaaaaattataaa
acttcttggtcaattactgtacataaagcacaaggttctgaatttaataatataagtcta
atactgccaaataaaaatttaaaaattttgaaaaaagatattttgtatactggaattaca
agaactcggaaacaattaaatattttttcaacaaaagaaatatttattaaaacagtctta
aaaaattaa

DBGET integrated database retrieval system