KEGG   Bifidobacterium asteroides: BAST_0057Help
Entry
BAST_0057         CDS       T02271                                 

Definition
(GenBank) glycoside hydrolase clan GH-D
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
bast  Bifidobacterium asteroides
Pathway
bast00052  Galactose metabolism
bast00561  Glycerolipid metabolism
bast00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bast00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BAST_0057
  Lipid metabolism
   00561 Glycerolipid metabolism
    BAST_0057
   00600 Sphingolipid metabolism
    BAST_0057
Enzymes [BR:bast01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BAST_0057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Melibiase_2 GHL10 Glyco_hydro_31 DUF4838
Motif
Other DBs
NCBI-ProteinID: AFU70662
UniProt: K4IJC8
Position
80301..82421
Genome map
AA seq 706 aa AA seqDB search
MFFPQPVHSEQPVTYMALGPITPGADIPDIRGLYAGPDLDGLEQTPAWTSTHSPLLLEHA
QNTYLHPGLTGHRIVSDPEGIQAGRSWSPRFLVEGKPEQTADSLTIKARDEDAQLGLETR
VEAMAGGSLRIRHTLRNLGTDPFLLEGLEVRLPLDDQQTQILDFAGRHERERSPQRHDLA
DGAWVREFRWGRTGFEGPVVMVGTPGFNFHHGRVLCVQPAWSGNTVLRVERNSATPAGIS
AGELLLPGEVVLGQGQEYSTPWIVVTASDHGMDPIMNSLHAWERTLPEHPREQPVILNVW
EAITFNHDFDTLRDLADRAARIGVERLVLDDGWFHLRRDDTAGLGDWWVDPAVWPQGLEP
LVDYVHKLGMQFGLWFEPEMINPNSDAFRDHPEWVMRASSRNPELQRNQLVLDLTNPQAF
NHVLEAMTKVLESCHIDYVKWDHNRDLLEAGSQAHGGAPAIHEQTLAYYRLLDTLRARFP
KVEWESCASGGGRIDLGVIEKIRRFWNSDMTDALSRQMIQRWTEQTVAPEYIGAHVSQPS
SQQTGRTYSLDFRAATAVFGSMGIEWDIRQASEEDLERLKEWVTWYKANRGFLHSGRVVR
LDLADPSVLAHGVVAPDRSRAILAHVQLDESLHNRGVYLRIPGLDPKARYRLAWTGPAKP
RASLEPLDSTGPLGTAEVTGTYLERVGVRIPRCQPETIRLIDLVRV
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgttctttccacagccggtccattctgaacagccagtcacctatatggctctggggccc
attacgccgggtgctgatattcctgacatcaggggactgtatgcaggccccgacctggat
ggtttggaacagactcccgcctggacctcgacccattcgcccctgctgttggagcatgcg
cagaacacctacctgcatcctggcctgacagggcatcggattgtatcagaccccgagggc
atccaggctggccgttcctggtcgccccgattcctggtggagggcaagcccgagcagacc
gctgactcgctgaccatcaaggcccgcgatgaggatgcccagctagggttggaaaccagg
gtggaggcaatggccggcggctccctgcggattcgccataccctgcgcaatctgggcacc
gatcctttcctgttggagggtctggaggtccgtctgcccttggacgaccagcagacccag
attctggacttcgccggcaggcacgagcgtgagcgcagcccccagcgccatgacctggcc
gacggagcctgggtgcgtgagttccgctggggccgcaccggtttcgaggggcccgtggtc
atggtgggcaccccagggttcaacttccatcacggcagggtgctctgcgtccagccggct
tggagcgggaacacggtgcttcgggtggagcggaacagcgccaccccggcaggcatcagc
gctggtgaactccttctgcccggcgaggtggtcttgggccagggtcaggagtacagcacg
ccctggatcgttgtcacggcctccgaccatggcatggatccgatcatgaacagcctgcac
gcctgggagcgcaccctgcccgagcatccgcgcgagcagccggtcatcctgaatgtctgg
gaggccatcaccttcaaccacgacttcgacaccctgcgcgacctggccgaccgcgccgca
cgcatcggggtggagcggctcgttctggacgacggctggttccacctgcgccgggacgac
acggccggtctgggcgactggtgggtggacccggcggtctggccccagggtctggagcct
ttagttgattatgtccataaattggggatgcagttcggcctctggttcgagccggagatg
atcaatccgaattcggatgccttccgtgaccatcctgagtgggtcatgagggcatcctcc
agaaacccggagctgcagcgcaaccagctggtcctggacctgaccaacccccaggccttc
aaccacgtgctggaggccatgaccaaggttctggagtcctgccacatcgactacgtcaag
tgggaccacaaccgtgacctgcttgaggccggttcccaggcccacggcggagcgccggcc
atccacgagcagacactggcctactaccgcctgctggacactctacgcgctcgcttcccc
aaggtcgagtgggagtcctgcgcctcgggcggcggtcgcatcgatctgggcgtgatcgag
aagatccgccgcttctggaactccgacatgaccgatgccctgagcaggcagatgatccaa
cgctggaccgagcagaccgtggctcccgagtatatcggcgcccatgtctcccagccctcc
tcccagcagaccggcagaacctacagcctggatttccgggcggccacggccgtcttcggg
tccatgggcatcgagtgggacatccgccaggccagcgaggaggacctggagcggctcaag
gagtgggtcacctggtacaaggccaaccgtggcttcctccactccggccgcgtggtccgc
ctggacctggccgacccttcggttctggcccatggtgtagtggcccccgaccgcagccgt
gccatcctggcccatgtccagttggacgaatccctgcataatcgtggtgtttatctacgt
attcccggcctggatcccaaggcccggtaccggctggcttggaccggccccgccaagccc
agggcttcgcttgagcctttggattcgacgggcccgctggggaccgccgaggtcaccggc
acctatctggagcgcgtgggcgttcgcataccccgctgccagcccgagaccatccgtctg
attgacctggtccgggtctga

DBGET integrated database retrieval system