KEGG   Bifidobacterium asteroides: BAST_0083Help
Entry
BAST_0083         CDS       T02271                                 

Definition
putative lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bast  Bifidobacterium asteroides
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bast00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BAST_0083
Enzymes [BR:bast01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BAST_0083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
119054..120145
Genome map
AA seq 363 aa AA seqDB search
MSVQLVEERRYDQIMKERVLPDLASCRSDGWMISHDGGEDGGTLLDKAHVRGVDPSRLLH
YVCYDRTLFRQGAVESGSALVRGAVIISFGFSEFADKYQEMAWYFLMQGYSVCIPEHWGH
GFSGRGVNDPSLIWVDHWHRYVADLAAFCSQVGQQYAQDKPMVLYAHSMGGGVAARMLET
FPSLIDKAVLSSPMIAPRTGFMPSVAWTAANAACMMGRSRSMVPGFGPFRPELDMGKYPN
GSQARVSWAHKLRARELHYQTSAATFGWVRESLEMSRAILRPDRCSRVETPLLLFQAQPD
RFVLPMPQNRFVDQVQQGGCQATLVRIPGSMHELYQMPDKVLRPYLERIFDFFDQPWQLA
DDR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtccaactggttgaggagcgccgctacgaccaaatcatgaaggagcgtgtcctt
cctgacttggcctcctgtcgcagtgacggatggatgatctcccatgacggcggcgaggac
gggggaaccttgttggacaaggcccatgtcaggggcgtagacccatcccggctcttgcat
tacgtctgctatgaccggacgcttttccgccagggggcggtggagtcaggatcggctctt
gtgcgcggggccgtaatcatctccttcggtttttcggaattcgccgacaagtatcaggag
atggcctggtatttcctgatgcaggggtattctgtctgcattcccgagcactggggacac
gggttctcgggccggggcgtaaacgatcccagtctgatatgggtggatcattggcatcgg
tatgtggcggacctggccgctttctgctcccaggtgggtcagcagtatgcccaggacaag
cccatggtgctctatgcccactccatgggcggcggtgtggctgcgcggatgctggagact
tttccttcgcttattgacaaggcggtcctgtcatcgccgatgattgcgccgcggaccggg
ttcatgccctcagtggcctggaccgcagccaacgccgcctgcatgatgggccgctctcgc
agcatggtcccgggattcggaccattccgtcccgagctggacatgggcaagtaccccaat
ggcagccaggcgcgggtgtcctgggcccataagttgcgggccagggagctgcactaccag
accagcgccgccactttcggctgggtcagggagagcctggagatgagccgggccatactg
cgacccgaccggtgcagtcgggtggagacccctctgttgcttttccaggcgcagcctgac
cgattcgtgttgccgatgccccagaaccgttttgtcgaccaggtccagcagggcggctgc
caggccacgctggtgcgcatcccaggcagcatgcacgagctctaccagatgccggacaag
gtcctgaggccatacttggagcgcatcttcgacttttttgaccagccctggcagctcgct
gacgaccgctaa

DBGET integrated database retrieval system