KEGG   Bifidobacterium asteroides: BAST_0302Help
Entry
BAST_0302         CDS       T02271                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bast  Bifidobacterium asteroides
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bast00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BAST_0302
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BAST_0302
Enzymes [BR:bast01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BAST_0302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
409244..410575
Genome map
AA seq 443 aa AA seqDB search
MPKVNTQDDVLHVVGGRPLHGTIQVRGAKNFVSKAMVAALLAPGVSVLKNVPEIRDVQVV
SDLLRLHGVKVDVRPQEGVVTIDASHVELADVADVDTLSGSSRIPILFSGPLLHRMGEAF
IPVLGGCRIGSRPIDFHLETLRKLGANVDKEHEAGIHITAPDGLHGAKIHLPYPSVGATE
QTLLAAVLAEGRTELSGAATEPEIMDLVAVLQKMGAQISVDVDRTIRIEGVPSLKGFTHT
SLPDRIEAASWASAALATHGDIMVKGAHQPDMMTYLNVFRKIGGQFDVRDDGIRFWHPGG
DLRPVAIETDVHPGFMTDWQQPLVVALTQAKGLSIVHETVYENRFGFTKPLIQMGATIQL
YKECLGSLPCRFQQRNFNHSAVIFGPTPLTGQDIDVPDLRGGFSHLIAALTASGPSNVHG
ISLIDRGYEDFRDKLLALDAQID
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaggtgaatacacaggatgatgtactgcatgtggtgggcggcaggcccctgcat
ggcaccatacaggtccgtggggccaagaacttcgtcagcaaggccatggttgccgccctg
ctggctcctggtgtatcagtgctcaagaacgtacctgaaatccgcgacgtccaggtggtc
tccgacctgctgaggctgcatggtgtcaaggtggatgtccgtccacaggagggcgtggtc
accattgatgccagccatgtggagctggccgacgtggccgatgtggacaccctgtcgggc
tcttcccgcatacccatcctcttctccgggccgcttctgcatcggatgggagaggctttc
attcccgtgcttggcggctgccgcatcggcagcaggcccatcgatttccatctggagacc
ctgcgcaaactgggggccaatgtcgacaaggagcatgaggccggcatccacatcacagcg
ccggacggcctgcatggagccaagattcacctgccctacccctcggtgggcgcgacggag
cagaccctgctggcggctgtcctggctgaggggcgtactgagctgtcaggtgcggctacc
gagcctgagattatggacctggtggcggttctgcagaagatgggcgcgcagatttccgtg
gacgtggaccgaaccatccgcatcgagggtgtgccgtccctgaagggcttcacccatacc
tccctgcccgaccgaatcgaagccgcctcctgggcctccgccgccctggctacccatggc
gacatcatggtcaagggcgcccaccagcctgacatgatgacctacctgaacgtcttccgc
aagatcggcggccagttcgatgtgcgcgacgacggcatccgcttctggcatccgggtggc
gacctgcgccccgtggccatcgagaccgacgtgcaccccgggttcatgactgattggcag
cagcccctggtggtggccctgacccaggccaagggtctttccatcgttcatgagaccgtc
tacgagaatcgtttcggcttcaccaagccgctgattcagatgggtgccaccatccagctc
tacaaggagtgcctgggatctctgccctgccgcttccagcagcgcaacttcaaccactcg
gccgtcatcttcgggcccaccccgttgaccggccaggacatcgatgtgcccgacctgcgt
ggcggcttcagccacctgattgccgcgctgacggcatccggcccctccaacgttcacggc
atctccctgattgaccgcggctacgaggacttccgcgacaagttgctggccctggacgcg
cagatcgactga

DBGET integrated database retrieval system