KEGG   Bifidobacterium asteroides: BAST_0472Help
Entry
BAST_0472         CDS       T02271                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bast  Bifidobacterium asteroides
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bast00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BAST_0472
Enzymes [BR:bast01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BAST_0472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
660513..662627
Genome map
AA seq 704 aa AA seqDB search
MTDNAVRTKDHSVSQGITRLPDRLIFGCAYYDEYMPYERVDKDMSMMKSACINTIRIAES
TWSTLEPQPGVFDLSHVDRVLDAAERFGIQVIVGTSTYAVPSWLAAMHPDVLADTPKGHN
RYGARQIMDIVNPSYRYYGERVIRRLISHVADNPQVIGYQVDNETKYYDCVSPDMQRLFV
KDLRRRFDDDLDRLNAAFGLDYWSNRIDSWEDFPDLTGTINASLGSAFDRFRRSQVSRYL
AWQAGIVREYAREDQFITHNFDFDWGPGWSYGVQPAVDHFEAAGCLDVAGVDIYHPTEDD
LTGKEIAFGGDMTRSLKGGANYLVLETEAQGQNGWLPYPGQLRLQAYSHLASGADGVMYW
HWHSIHNSFETYWKGLLSQDMDPNPTYEEAGRFGRQIAQKGVGERLINLQKRNKVAIMVG
NDSLTALDWFSLETGFPRQQGQISYNDVVRRVYDALFELNIECDFISDKADQSRLGHYAM
VVVPALYSTNQDTLKALADYVRQGGHLVATLRSFVADENLKVWHDKAPHLLTDVFGIDYN
QFTRPGKDLTLDLRGADQAGPACQGLIELLNPRPGTQVLASYDHPVWGRYAAVTRNDYGN
GIAEWIGTLPSAQGMRMLLSDAADAAGLSGPARDLAGLVTVREGINALGERVAYLLNYSS
KEVRLDAPYGGHLLVADGQADPQAHVDQGQSMTIGPWDLAVIVQ
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaatgcagtccgaaccaaggaccattcggtttcgcagggtatcacgcgcctc
ccggacaggctcatcttcggctgtgcctactacgacgaatacatgccctatgagcgggtg
gacaaggatatgtccatgatgaagtccgcctgcatcaacaccattcgtatcgccgaatcc
acctggagcactctggagccccagcctggcgtattcgacctcagccatgtggaccgtgtg
ctggatgctgctgaacgcttcggcattcaggtcatcgtgggcacctccacctatgccgtc
ccctcctggctggcagccatgcatccggatgtcctggcggacacccccaagggccacaat
cggtatggggctcgccagattatggacatcgtcaacccctcctaccggtactatggcgag
cgcgtcatacgcaggctgataagccatgtggccgacaacccccaggtgatcggctaccag
gtcgacaacgagaccaagtactacgactgcgtatcgcctgacatgcagcgcctcttcgtc
aaggatctgcggcggcgctttgacgatgatctggaccgcctcaatgcggcctttggcctg
gactactggtcaaacagaatcgactcctgggaggactttcccgatctgaccgggaccatc
aatgcatcgctgggttcggctttcgaccgcttccgtcgaagccaggtcagccgctacctg
gcctggcaggctggcattgtgcgcgaatatgcccgcgaggaccagttcatcacccacaac
ttcgatttcgattggggtcctggctggtcatatggtgttcagccagccgtcgatcatttc
gaagcggccggatgcctggacgtggccggtgtggacatctaccatcccaccgaggacgac
ctgaccggcaaggagattgccttcggcggggacatgacccgcagtctgaagggtggcgcc
aactacctggttctggaaaccgaggcccaggggcagaacggctggctgccctacccaggg
cagttgcggttgcaggcatacagccatctggcctctggggctgacggggtcatgtactgg
cactggcattccatccacaactcttttgagacctactggaaggggctgctttcgcaggat
atggaccccaaccccacctatgaggaggccggtcggttcggcaggcagatagcgcagaag
ggtgtgggggagcgtctgatcaacctccaaaagcgcaacaaggtagccatcatggtgggc
aacgactccctgaccgcactggactggttctccctggagaccggcttcccccgtcagcag
gggcagatctcctacaacgatgtggtcagacgggtctacgatgccctcttcgagctcaac
atcgagtgcgatttcatcagcgacaaggccgaccagtcccggctgggccactatgccatg
gtcgtggttcccgccttgtacagcaccaatcaggatacgctgaaggcactggccgattat
gtccgtcagggaggtcacctggtggccacgctgcgctcctttgtggcggacgagaacctc
aaggtctggcatgacaaggctccgcacctgctgaccgacgtgttcggcatcgactacaac
cagttcacccgccccggcaaggatctgaccctggatctgcgtggggccgaccaggccgga
ccggcctgccaggggctgattgagctgctgaatccgcgccccggcactcaggtcctggcc
tcctatgaccatccggtctggggacggtatgcggctgtgacccgtaatgattacggcaac
gggatcgcggagtggatcggcaccctgccctcggcccagggcatgcggatgctgctttcg
gatgcggcggatgcggctggcttgagcggtcctgcccgggacctggctggcctggtcacc
gtgcgggagggcatcaacgccctgggagagcgggtcgcttacctgctcaattattcatcc
aaggaggtcaggctggacgcgccctacggggggcatctgctggtggctgacgggcaggct
gatcctcaagcgcatgtggaccagggccagtccatgaccattggaccctgggatctggcg
gtcatcgttcaatag

DBGET integrated database retrieval system