KEGG   Bifidobacterium asteroides: BAST_0491Help
Entry
BAST_0491         CDS       T02271                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bast  Bifidobacterium asteroides
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bast00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
687011..688285
Genome map
AA seq 424 aa AA seqDB search
MSHLAVMSEGRQGGLSVGRERTLAEWSLRDDADRSRSLVILGSTGSIGTQALDLISRHRA
RFQVTGLAAGGAHVELLARQARDFGVKRLALADKAQVPALQRALEALGLTGIQVEAGMEA
VQALAGSGSDLVLNGITGSVGLRPSIAALQAGSQLALANKESVVAGGHLLFDAEIRPGQI
NPVDSEHSAIWQSLRSGQHGEVARLVVTASGGPFRGWSRQAMREVTPEQALNHPTWSMGP
VVTINSSTMVNKGLEVIEASRLFRIDPERITVVVHPQSVVHSMVQFQDGATISQASPPDM
RLPIALGLSAPARLDNVAAACDWSKASTWTFEPLDDEAFPAVNLARRALGSCEPMTAVFN
AANEEAVRAFLNHRLPYLNIVKTIRSVMDAMETHLPGTFTSVEVMEQVEHEARQRADALI
DMTA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatctggcagtgatgagtgaaggcaggcagggcggtctgtcggtcggacgtgag
cgcaccttggcggaatggtcgctcagggatgatgccgaccggtctcgcagtctggtcatc
ctgggatccacaggatccatcggcactcaggccctggatctgatcagtcgtcacagggct
cgcttccaggtgactggattggccgctggcggcgcgcatgtcgagctcctggcccgccag
gcccgcgattttggcgtgaagcgtctggctctggccgacaaggctcaggttccggccctg
cagcgggctctcgaggccctgggattgaccggcatccaggtagaggcaggcatggaggcg
gttcaggctctggccggttccggcagtgaccttgttctcaatggcatcaccggatcagtt
ggtctgcgtccatccattgcagctttgcaggctggatcccaactggctctggccaacaag
gagtccgtggtagccggcggccatctgctcttcgacgccgagatacggccgggtcagatc
aaccctgtcgactcggaacattcggccatctggcagtccctgcgttcggggcagcatgga
gaggtagcccgtctggtggtcaccgcctcaggaggtcccttccggggctggagccgccag
gccatgcgcgaggtcacccctgaacaggccctgaaccatccgacctggtccatgggcccg
gtggtcaccatcaactcctccaccatggtcaacaagggtctggaggtcatcgaggccagt
cgactcttccggatcgatcccgagcggatcaccgtggtggtccaccctcagtccgtggtc
cactccatggtccagttccaggacggggccaccataagccaggcctcgcctccggatatg
cgtctgcccatcgccctgggcctgtcggcgcccgcccgtctggacaacgtggctgcggcc
tgtgactggtccaaggccagcacctggacttttgagcccttggatgacgaggctttcccg
gcggtcaatctggccaggcgggctctgggaagctgcgagcccatgactgcggtcttcaac
gccgccaacgaggaggcggtcagggccttcctgaatcaccggctgccctacctgaacatc
gtcaaaaccatccgttcggtcatggatgccatggaaacgcatcttccgggaacattcaca
tccgtggaggtaatggagcaagtcgagcatgaggcgcgccaaagggccgatgctttgata
gacatgacagcgtga

DBGET integrated database retrieval system